PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Lsa009237 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
|
||||||||||||
Family | MIKC_MADS | ||||||||||||
Protein Properties | Length: 235aa MW: 26419 Da PI: 5.4961 | ||||||||||||
Description | MIKC_MADS family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 81.8 | 4.5e-26 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n + rqvtfskRr g+lKKAeEL vLCda+va++ifs tgkl+ey+s Lsa009237 10 KIDNITARQVTFSKRRRGLLKKAEELAVLCDADVALVIFSATGKLFEYAS 59 69**********************************************86 PP | |||||||
2 | K-box | 45.9 | 2.4e-16 | 82 | 172 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + + + + l+ e +++ ke+ re+ hl GedL+ L+l+eLq+Le+ Le +l+++ ++K+e + ++i lq+k +l eenk L+++++ Lsa009237 82 APSLNLQLLESEESRMSKEVLDKNRELSHLRGEDLNGLTLEELQRLESLLEGGLNRVLQTKDERIANEIASLQQKGFQLMEENKLLKQQMM 172 556677888899999999999999****************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.0E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.352 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.89E-37 | 2 | 73 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.49E-29 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.8E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.59 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.3E-14 | 88 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MAREKIKIRK IDNITARQVT FSKRRRGLLK KAEELAVLCD ADVALVIFSA TGKLFEYASS 60 SMQELLGKYK LHSTNNVNKV DAPSLNLQLL ESEESRMSKE VLDKNRELSH LRGEDLNGLT 120 LEELQRLESL LEGGLNRVLQ TKDERIANEI ASLQQKGFQL MEENKLLKQQ MMSLTSVGKR 180 PRTTAAELDN IVINPEDQVQ SSESVATNVY SCNSGPPPDQ DDWSDTSLKQ ALPFN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023750478.1 | 1e-172 | MADS-box protein AGL24-like isoform X1 | ||||
Swissprot | Q9FUY6 | 7e-79 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
Swissprot | Q9FVC1 | 3e-79 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A2J6M7S3 | 1e-150 | A0A2J6M7S3_LACSA; Uncharacterized protein | ||||
STRING | EOY15444 | 3e-96 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 3e-65 | MIKC_MADS family protein |