PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Lsa007038 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
|
||||||||||||
Family | bZIP | ||||||||||||
Protein Properties | Length: 158aa MW: 17417.5 Da PI: 10.3287 | ||||||||||||
Description | bZIP family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.6 | 7.4e-15 | 85 | 145 | 1 | 61 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 +ke kr +r+ +NR++A+ R+RKka++ eLe +vke+e++N++L ++l++l++e + l+ Lsa007038 85 DKENKRLKRLLRNRVSAQQARERKKAYLNELEVRVKEIEKKNSELEERLSTLQNENQMLRH 145 5899****************************************************98865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 7.5E-16 | 82 | 149 | No hit | No description |
SMART | SM00338 | 8.9E-13 | 85 | 149 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.5E-14 | 86 | 146 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.599 | 87 | 150 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.25E-12 | 89 | 147 | No hit | No description |
CDD | cd14704 | 4.06E-17 | 90 | 141 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 92 | 107 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MQEPTATSSL VASLPSSSER SSSSALHIEI KEGMESDDEI RRVPEMGGEA AGASVSGGDT 60 GSGAGPDRVQ SSNVGSRKRG RTPADKENKR LKRLLRNRVS AQQARERKKA YLNELEVRVK 120 EIEKKNSELE ERLSTLQNEN QMLRHILKNT TAGMQEKK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2oqq_A | 3e-16 | 110 | 149 | 3 | 42 | Transcription factor HY5 |
2oqq_B | 3e-16 | 110 | 149 | 3 | 42 | Transcription factor HY5 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023759627.1 | 1e-109 | transcription factor HY5-like | ||||
Swissprot | Q9SM50 | 2e-65 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A2J6LMY0 | 1e-108 | A0A2J6LMY0_LACSA; Uncharacterized protein | ||||
STRING | XP_008445197.1 | 1e-71 | (Cucumis melo) | ||||
STRING | XP_004138731.1 | 1e-71 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 2e-47 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|