PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LPERR09G00910.1

Organism

Leersia perrieri

Taxonomic ID

77586

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia

Family

MYB

Protein Properties

Length: 273aa MW: 29841.8 Da PI: 10.3948

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LPERR09G00910.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.3	1.5e-17	14	59	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd l ++v ++G ++W++I++ ++ gR++k+c++rw + LPERR09G00910.1 14 KGPWSPEEDTALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 59 79****************************.*********985 PP
2	Myb_DNA-binding	54.1	3.7e-17	68	110	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEd+ +++a++++G++ W+tIar + gRt++ +k++w++ LPERR09G00910.1 68 PFTPEEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 110 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.576	9	64	IPR017930	Myb domain
SuperFamily	SSF46689	1.2E-31	11	107	IPR009057	Homeodomain-like
SMART	SM00717	2.6E-15	13	62	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-17	14	59	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-25	15	67	IPR009057	Homeodomain-like
CDD	cd00167	4.32E-15	16	58	No hit	No description
SMART	SM00717	1.7E-14	65	113	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.655	66	115	IPR017930	Myb domain
CDD	cd00167	5.54E-12	68	111	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-23	68	114	IPR009057	Homeodomain-like
Pfam	PF00249	1.2E-14	68	110	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 273 aa Download sequence Send to blast
MACRRGGGEV DRIKGPWSPE EDTALQRLVG RHGARNWSLI SKSIPGRSGK SCRLRWCNQL 60 SPQVEHRPFT PEEDDTILRA HARFGNKWAT IARLLSGRTD NAIKNHWNST LKRKHTNSSD 120 DDHLLLPRPL KRTTSSGSPS GSDLSDSSHH SLPSHMPSSP PHQLLYRPLA RAGGVVVPPP 180 PATSLSLSLS LPGLDHQQPQ PDPSPSESAV PLPTTPASQM PPPPPFSAEF LAMMQEMIRI 240 EVRNYMSGSG VDPRSPPDAV RAASRIMGMA KIE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-38	11	114	4	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00274	DAP	Transfer from AT2G23290	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LPERR09G00910.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012617	1e-140	CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015612590.1	1e-118	transcription factor MYB44
Swissprot	Q9FDW1	5e-76	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A0D9XBE3	0.0	A0A0D9XBE3_9ORYZ; Uncharacterized protein
STRING	LPERR09G00910.1	0.0	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP789	38	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37260.1	6e-65	myb domain protein 73

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]