PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LPERR03G04690.4

Organism

Leersia perrieri

Taxonomic ID

77586

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia

Family

bHLH

Protein Properties

Length: 92aa MW: 10406.7 Da PI: 8.5297

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LPERR03G04690.4	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	21.7	3.6e-07	20	59	15	54
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + ++L++llP+a ++ ++ + +L+++++YI+sL LPERR03G04690.4 20 QISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCNYIRSL 59 789999*******8899*****************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.280.10	4.3E-8	4	78	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profile	PS50888	9.813	5	59	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	6.94E-9	19	81	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	2.6E-4	20	59	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MSSRRSRSRQ SGSSRITDEQ ISDLVSKLQD LLPEARLRSN DRVPSSRVLQ ETCNYIRSLH 60 REVDDLSERL SELLASSDMS SAQAAIIRSL LM

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269\|PubMed:22363621}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LPERR03G04690.4

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK069569	1e-124	AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014752670.1	3e-45	transcription factor ILI6 isoform X2
Refseq	XP_014752676.1	3e-45	transcription factor ILI6 isoform X2
Refseq	XP_015629922.1	2e-45	transcription factor ILI6 isoform X7
Refseq	XP_024313619.1	3e-45	transcription factor ILI6 isoform X2
Swissprot	B8APB5	1e-46	ILI6_ORYSI; Transcription factor ILI6
Swissprot	Q0DUR2	1e-46	ILI6_ORYSJ; Transcription factor ILI6
TrEMBL	A0A0D9VQ20	8e-55	A0A0D9VQ20_9ORYZ; Uncharacterized protein
STRING	OMERI03G05010.1	6e-45	(Oryza meridionalis)
STRING	OS03T0171300-01	6e-45	(Oryza sativa)
STRING	ORGLA03G0051100.1	6e-45	(Oryza glaberrima)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26945.1	1e-21	bHLH family protein