PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LPERR02G00370.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 237aa MW: 26770.3 Da PI: 8.9042 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.7 | 7.5e-29 | 29 | 78 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+++ rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+lye++s LPERR02G00370.1 29 RIEDTTSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS 78 8***********************************************86 PP | |||||||
2 | K-box | 76.9 | 5.4e-26 | 106 | 193 | 10 | 99 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++ +++++ e+ L k+ie+++r + +llGe+L+s+s++eLq+Le qLeksl++iR+kK+++l++qi el++ke +l +en+aLr + + LPERR02G00370.1 106 CA--QQKWKSEAITLGKKIESIERYKSKLLGEGLGSCSMQELQELEVQLEKSLSSIRQKKQKMLMDQILELREKETNLLKENRALRDQCK 193 44..59********************************************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.73 | 20 | 80 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 9.3E-36 | 20 | 79 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.8E-30 | 22 | 101 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 22 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-28 | 22 | 42 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.4E-26 | 29 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.00E-34 | 30 | 98 | No hit | No description |
PRINTS | PR00404 | 1.1E-28 | 42 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-28 | 57 | 78 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.5E-26 | 107 | 192 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.613 | 108 | 198 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MAGDLQQQQQ GGGALTAAKG RRGRREMRRI EDTTSRQVTF SKRRSGLLKK AFELSVLCDA 60 EVALIVFSPR GRLYEFASAP DLQRTIDRYL NHTKNTSSRE QGDRLCAQQK WKSEAITLGK 120 KIESIERYKS KLLGEGLGSC SMQELQELEV QLEKSLSSIR QKKQKMLMDQ ILELREKETN 180 LLKENRALRD QCKAALSSSA MELNNEDSNN AGVGNDDDDR HYMDVETELV IGRPGTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n6j_A | 3e-18 | 22 | 105 | 2 | 84 | Myocyte-specific enhancer factor 2B |
1n6j_B | 3e-18 | 22 | 105 | 2 | 84 | Myocyte-specific enhancer factor 2B |
1tqe_P | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-18 | 22 | 105 | 3 | 85 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LPERR02G00370.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015625202.1 | 1e-104 | MADS-box protein SOC1 isoform X1 | ||||
Swissprot | Q9XJ60 | 4e-69 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
TrEMBL | A0A0D9VB42 | 1e-172 | A0A0D9VB42_9ORYZ; Uncharacterized protein | ||||
STRING | ORGLA02G0003200.1 | 1e-103 | (Oryza glaberrima) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45660.1 | 6e-48 | AGAMOUS-like 20 |