PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj5g3v1597270.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 167aa MW: 18652.8 Da PI: 8.7783 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 110.2 | 9.2e-35 | 10 | 67 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+ Lj5g3v1597270.1 10 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCNVKKRVERSFTDPSIVVTTYEGQHTHS 67 8********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.6E-33 | 2 | 69 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-29 | 3 | 69 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.743 | 4 | 69 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.2E-40 | 9 | 68 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.1E-27 | 10 | 66 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009624 | Biological Process | response to nematode | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTSASC NVKKRVERSF TDPSIVVTTY 60 EGQHTHSSPV MPRAGFGGAP IRPGYSTACG ATNFGSVLQG NYLSQYQHHP HQHLVNTLSS 120 LQGFPYSDSP SSKNAAFVTQ EMQHATAFLM DHGLLQDVVP SHMLKEE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-29 | 2 | 70 | 10 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 2e-29 | 2 | 70 | 10 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.13314 | 0.0 | cell culture| protoplast |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00069 | PBM | Transfer from AT2G47260 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj5g3v1597270.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT096266 | 2e-70 | BT096266.1 Soybean clone JCVI-FLGm-20H23 unknown mRNA. | |||
GenBank | DQ322697 | 2e-70 | DQ322697.1 Glycine max WRKY51 mRNA, complete cds. | |||
GenBank | DQ322698 | 2e-70 | DQ322698.1 Glycine max WRKY54 mRNA, complete cds. | |||
GenBank | KT031230 | 2e-70 | KT031230.1 Glycine max clone HN_CCL_159 WRKY transcription factor (Glyma03g37940.1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003591381.1 | 8e-74 | probable WRKY transcription factor 23 | ||||
Swissprot | O22900 | 4e-51 | WRK23_ARATH; WRKY transcription factor 23 | ||||
TrEMBL | A0A445LI01 | 6e-73 | A0A445LI01_GLYSO; WRKY transcription factor 23 isoform C | ||||
TrEMBL | A0A445LI12 | 5e-73 | A0A445LI12_GLYSO; WRKY transcription factor 23 isoform B | ||||
TrEMBL | G7ICW1 | 2e-72 | G7ICW1_MEDTR; WRKY transcription factor | ||||
STRING | AES61632 | 3e-73 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1002 | 34 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47260.1 | 2e-53 | WRKY DNA-binding protein 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|