PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1736110.1
Organism
Lotus japonicus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28313.1 Da    PI: 9.5708
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1736110.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.89.2e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeyss
  Lj4g3v1736110.1  9 KRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIVFSTKGKLYEYSS 59
                     79***********************************************96 PP
2K-box103.72.3e-34791754100
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      ++  ++++a +e++  e+akLk+++e Lqr+qR+++Ge+L+sLslk+Lq+LeqqL+++lk+iRs+Kn+ l+e+i+elqkk k+lqe+n+ L+kk
  Lj4g3v1736110.1  79 RQADANDQAPSENWVLEHAKLKARMEVLQRNQRNFMGEELDSLSLKQLQNLEQQLDSALKHIRSRKNQALFESISELQKKDKALQEQNNLLTKK 172
                      44555788889*********************************************************************************** PP

            K-box  98 lee 100
                      ++e
  Lj4g3v1736110.1 173 IKE 175
                      987 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.366161IPR002100Transcription factor, MADS-box
SMARTSM004328.7E-40160IPR002100Transcription factor, MADS-box
CDDcd002651.61E-42278No hitNo description
SuperFamilySSF554552.75E-33281IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.8E-2885173IPR002487Transcription factor, K-box
PROSITE profilePS5129716.41689179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KANEISVLCD AEVALIVFST KGKLYEYSSD  60
PCMERILERY ERYSYADKRQ ADANDQAPSE NWVLEHAKLK ARMEVLQRNQ RNFMGEELDS  120
LSLKQLQNLE QQLDSALKHI RSRKNQALFE SISELQKKDK ALQEQNNLLT KKIKEKEKAI  180
TTQEEQEGLQ NSANVASGLV TQPLESMNIG GSPEARCDER TPTPTPTPTR ANTINLPPWM  240
LRPTNDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-21174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-21174173Myocyte-specific enhancer factor 2B
1tqe_R2e-21174173Myocyte-specific enhancer factor 2B
1tqe_S2e-21174173Myocyte-specific enhancer factor 2B
6byy_A2e-21174173MEF2 CHIMERA
6byy_B2e-21174173MEF2 CHIMERA
6byy_C2e-21174173MEF2 CHIMERA
6byy_D2e-21174173MEF2 CHIMERA
6bz1_A3e-21174173MEF2 CHIMERA
6bz1_B3e-21174173MEF2 CHIMERA
6bz1_C3e-21174173MEF2 CHIMERA
6bz1_D3e-21174173MEF2 CHIMERA
6c9l_A2e-21174173Myocyte-specific enhancer factor 2B
6c9l_B2e-21174173Myocyte-specific enhancer factor 2B
6c9l_C2e-21174173Myocyte-specific enhancer factor 2B
6c9l_D2e-21174173Myocyte-specific enhancer factor 2B
6c9l_E2e-21174173Myocyte-specific enhancer factor 2B
6c9l_F2e-21174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.43240.0pod| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Vascular tissue of cauline leaves, floral shoot apex and valves of carpels and fruits. {ECO:0000269|PubMed:9502732}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v1736110.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549579.11e-125truncated transcription factor CAULIFLOWER A isoform X2
RefseqXP_028209377.11e-125truncated transcription factor CAULIFLOWER A-like isoform X2
SwissprotQ388761e-106AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBLI1MT911e-123I1MT91_SOYBN; Uncharacterized protein
STRINGGLYMA17G08890.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.12e-97AGAMOUS-like 8
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Wang C,Dehesh K
    From retrograde signaling to flowering time.
    Plant Signal Behav, 2015. 10(6): p. e1022012
    [PMID:26098376]
  5. Borghi M,Xie DY
    Tissue-specific production of limonene in Camelina sativa with the Arabidopsis promoters of genes BANYULS and FRUITFULL.
    Planta, 2016. 243(2): p. 549-61
    [PMID:26530959]
  6. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  7. McCarthy EW,Mohamed A,Litt A
    Functional Divergence of APETALA1 and FRUITFULL is due to Changes in both Regulation and Coding Sequence.
    Front Plant Sci, 2015. 6: p. 1076
    [PMID:26697035]
  8. Davin N, et al.
    Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants.
    Plant J., 2016. 86(5): p. 376-90
    [PMID:26952251]
  9. Hyun Y, et al.
    Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem.
    Dev. Cell, 2016. 37(3): p. 254-66
    [PMID:27134142]
  10. José Ripoll J, et al.
    microRNA regulation of fruit growth.
    Nat Plants, 2015. 1(4): p. 15036
    [PMID:27247036]
  11. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  12. Eldridge T, et al.
    Fruit shape diversity in the Brassicaceae is generated by varying patterns of anisotropy.
    Development, 2016. 143(18): p. 3394-406
    [PMID:27624834]
  13. Bemer M, et al.
    FRUITFULL controls SAUR10 expression and regulates Arabidopsis growth and architecture.
    J. Exp. Bot., 2017. 68(13): p. 3391-3403
    [PMID:28586421]
  14. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  15. Balanzà V, et al.
    Genetic control of meristem arrest and life span in Arabidopsis by a FRUITFULL-APETALA2 pathway.
    Nat Commun, 2018. 9(1): p. 565
    [PMID:29422669]