PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj4g3v1736110.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 247aa MW: 28313.1 Da PI: 9.5708 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.8 | 9.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeyss Lj4g3v1736110.1 9 KRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIVFSTKGKLYEYSS 59 79***********************************************96 PP | |||||||
2 | K-box | 103.7 | 2.3e-34 | 79 | 175 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++ ++++a +e++ e+akLk+++e Lqr+qR+++Ge+L+sLslk+Lq+LeqqL+++lk+iRs+Kn+ l+e+i+elqkk k+lqe+n+ L+kk Lj4g3v1736110.1 79 RQADANDQAPSENWVLEHAKLKARMEVLQRNQRNFMGEELDSLSLKQLQNLEQQLDSALKHIRSRKNQALFESISELQKKDKALQEQNNLLTKK 172 44555788889*********************************************************************************** PP K-box 98 lee 100 ++e Lj4g3v1736110.1 173 IKE 175 987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.366 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.7E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.61E-42 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 2.75E-33 | 2 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.8E-28 | 85 | 173 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.416 | 89 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KANEISVLCD AEVALIVFST KGKLYEYSSD 60 PCMERILERY ERYSYADKRQ ADANDQAPSE NWVLEHAKLK ARMEVLQRNQ RNFMGEELDS 120 LSLKQLQNLE QQLDSALKHI RSRKNQALFE SISELQKKDK ALQEQNNLLT KKIKEKEKAI 180 TTQEEQEGLQ NSANVASGLV TQPLESMNIG GSPEARCDER TPTPTPTPTR ANTINLPPWM 240 LRPTNDQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6byy_A | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 3e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 3e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 3e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 3e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.4324 | 0.0 | pod| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Vascular tissue of cauline leaves, floral shoot apex and valves of carpels and fruits. {ECO:0000269|PubMed:9502732}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj4g3v1736110.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003549579.1 | 1e-125 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
Refseq | XP_028209377.1 | 1e-125 | truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
Swissprot | Q38876 | 1e-106 | AGL8_ARATH; Agamous-like MADS-box protein AGL8 | ||||
TrEMBL | I1MT91 | 1e-123 | I1MT91_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA17G08890.1 | 1e-124 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 2e-97 | AGAMOUS-like 8 |