PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v3212150.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 88aa MW: 10638.4 Da PI: 11.1196 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 59.5 | 6.9e-19 | 2 | 87 | 284 | 373 |
GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 ++Ere++gr+++nv+aceg er+ r et+++W+ r ++aGFk+ pl++k +++ ++ lrk + d + ++++++ Wk+r L + W Lj3g3v3212150.1 2 MIEREMVGRNAMNVIACEGLERIDRPETYKQWQVRNTRAGFKQFPLNQKLVSKFRTKLRKWHHD----DFVNNWMLQSWKGRILSGSTIW 87 79************************************************************77....5679**************9999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 14.662 | 1 | 72 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.4E-16 | 2 | 87 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MMIEREMVGR NAMNVIACEG LERIDRPETY KQWQVRNTRA GFKQFPLNQK LVSKFRTKLR 60 KWHHDDFVNN WMLQSWKGRI LSGSTIWV |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, cotyledons, leaves and sepals. {ECO:0000269|PubMed:18500650}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v3212150.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004505853.1 | 9e-44 | scarecrow-like protein 34 | ||||
Swissprot | Q3EDH0 | 4e-30 | SCL31_ARATH; Scarecrow-like protein 31 | ||||
TrEMBL | A0A1S2YJS7 | 2e-42 | A0A1S2YJS7_CICAR; scarecrow-like protein 34 | ||||
STRING | XP_004505853.1 | 3e-43 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14801 | 8 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07520.1 | 2e-32 | GRAS family protein |