PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v1295890.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 175aa MW: 19605.4 Da PI: 8.9119 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 82.8 | 9.8e-26 | 7 | 72 | 6 | 73 |
YABBY 6 sseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelle 73 +e+vCyv+CnfCnt lavsvP +s+++vvtvrCGhC++llsvn+ + q+l+ ++ ++++e+ + Lj3g3v1295890.1 7 GTERVCYVHCNFCNTTLAVSVPCSSMLTVVTVRCGHCANLLSVNMGASLQTLPPQDP--QHFQEPSRK 72 589*************************************************99885..344444443 PP | |||||||
2 | YABBY | 133.1 | 3.6e-41 | 86 | 151 | 105 | 170 |
YABBY 105 edeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 ++e pr p irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl Lj3g3v1295890.1 86 VSHEQPRNIPPIRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 151 45677787788*****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.5E-71 | 8 | 151 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.83E-8 | 96 | 144 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 3.3E-5 | 99 | 145 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0010158 | Biological Process | abaxial cell fate specification |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MSMDMMGTER VCYVHCNFCN TTLAVSVPCS SMLTVVTVRC GHCANLLSVN MGASLQTLPP 60 QDPQHFQEPS RKELGSSSRC KAFEPVSHEQ PRNIPPIRPP EKRQRVPSAY NRFIKEEIQR 120 IKASNPDISH REAFSTAAKN WAHFPHIHFG LKLDGSKQAK LDQQGDATQK SNGLY |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.18290 | 0.0 | pod |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v1295890.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT134202 | 0.0 | BT134202.1 Lotus japonicus clone JCVI-FLLj-8G16 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004487438.1 | 1e-105 | putative axial regulator YABBY 2 | ||||
Refseq | XP_004487439.1 | 1e-105 | putative axial regulator YABBY 2 | ||||
Swissprot | Q9XFB0 | 3e-76 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | I3S155 | 1e-128 | I3S155_LOTJA; Uncharacterized protein | ||||
STRING | XP_004487438.1 | 1e-105 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1124 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 1e-78 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|