PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj1g3v3964520.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 153aa MW: 17520.1 Da PI: 8.3398 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 53.4 | 3.6e-17 | 79 | 113 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C + Tp+WR gp g+ktLCnaCG++y++ +l Lj1g3v3964520.1 79 CTHCLSQRTPQWRAGPLGPKTLCNACGVRYKSGRL 113 *******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 7.9E-15 | 73 | 123 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.33E-15 | 74 | 137 | No hit | No description |
PROSITE profile | PS50114 | 11.095 | 77 | 109 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 5.6E-14 | 77 | 114 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.76E-12 | 78 | 125 | No hit | No description |
Pfam | PF00320 | 5.5E-15 | 79 | 113 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 79 | 104 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MWSHHLNPQN EAFGPDPPLL KQDYWLADSE LIVKKEEQEV TTKEEQEVVV VVKKEIIVKE 60 EFEDGEVSNN GQNPMPRRCT HCLSQRTPQW RAGPLGPKTL CNACGVRYKS GRLHPEYRPA 120 KSPTFVSFLH SNSHKKVMEM RMAPLSSIPI SKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.25392 | 0.0 | cell culture |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj1g3v3964520.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT093501 | 1e-80 | BT093501.1 Soybean clone JCVI-FLGm-14K19 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027352729.1 | 1e-80 | GATA transcription factor 5-like | ||||
Swissprot | O82632 | 1e-34 | GATA9_ARATH; GATA transcription factor 9 | ||||
TrEMBL | A0A371EV45 | 7e-75 | A0A371EV45_MUCPR; GATA transcription factor 9 (Fragment) | ||||
STRING | XP_007161927.1 | 1e-73 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8487 | 24 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60530.1 | 9e-36 | GATA transcription factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|