PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G60530.1 | ||||||||
Common Name | GATA4, T8B10.190 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 240aa MW: 26466.6 Da PI: 7.7856 | ||||||||
Description | GATA transcription factor 4 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.3 | 4.2e-18 | 160 | 194 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C + kTp+WR gp g+ktLCnaCG++y++ +l AT3G60530.1 160 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 194 *******************************9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF016992 | 1.2E-91 | 2 | 238 | IPR016679 | Transcription factor, GATA, plant |
SMART | SM00401 | 3.5E-15 | 154 | 204 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.728 | 154 | 190 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 7.13E-15 | 157 | 218 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 9.2E-14 | 158 | 192 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.46E-13 | 159 | 206 | No hit | No description |
Pfam | PF00320 | 6.2E-16 | 160 | 194 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 160 | 185 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MDVYGMSSPD LLRIDDLLDF SNDEIFSSSS TVTSSAASSA ASSENPFSFP SSTYTSPTLL 60 TDFTHDLCVP SDDAAHLEWL SRFVDDSFSD FPANPLTMTV RPEISFTGKP RSRRSRAPAP 120 SVAGTWAPMS ESELCHSVAK PKPKKVYNAE SVTADGARRC THCASEKTPQ WRTGPLGPKT 180 LCNACGVRYK SGRLVPEYRP ASSPTFVLTQ HSNSHRKVME LRRQKEQQES CVRIPPFQPQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.20781 | 0.0 | bud| floral meristem| flower| root| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145339709 | 0.0 | ||||
Genevisible | 251373_at | 0.0 | ||||
Expression Atlas | AT3G60530 | - | ||||
AtGenExpress | AT3G60530 | - | ||||
ATTED-II | AT3G60530 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and leaves, and to a lower extent in stems. {ECO:0000269|PubMed:12139008}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a member of the GATA factor family of zinc finger transcription factors. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00415 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G60530.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G60530 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF378881 | 0.0 | AF378881.1 Arabidopsis thaliana AT3g60530/T8B10_190 mRNA, complete cds. | |||
GenBank | AY039532 | 0.0 | AY039532.1 Arabidopsis thaliana AT3g60530/T8B10_190 mRNA, complete cds. | |||
GenBank | AY050476 | 0.0 | AY050476.1 Arabidopsis thaliana AT3g60530/T8B10_190 mRNA, complete cds. | |||
GenBank | Y13651 | 0.0 | Y13651.1 Arabidopsis thaliana mRNA for GATA transcription factor 4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_191612.1 | 1e-178 | GATA transcription factor 4 | ||||
Swissprot | O49743 | 1e-179 | GATA4_ARATH; GATA transcription factor 4 | ||||
TrEMBL | A0A178VBD2 | 1e-176 | A0A178VBD2_ARATH; GATA transcription factor | ||||
STRING | AT3G60530.1 | 1e-177 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3203 | 26 | 66 | Representative plant | OGRP68 | 17 | 287 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G60530.1 |
Entrez Gene | 825224 |
iHOP | AT3G60530 |
wikigenes | AT3G60530 |