PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj1g3v1341630.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 188aa MW: 21406.2 Da PI: 5.0431 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 103.7 | 2.3e-32 | 9 | 127 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGf F+Ptdeelv ++L+ k++ +++ ++i+e++ ++Pw+L+ k+ ++ +++yfFsk + nr+t+ gyWk+ g ++++ls Lj1g3v1341630.1 9 LPPGFLFSPTDEELVLHFLHCKASFLPCHP-NIIPELHHSLLDPWELNGKAFSSGNQYYFFSKVN--------GNRSTEIGYWKEIGVTEPILS 93 79*************************999.89**************966667789999999864........489999*************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +e+vg+kk Lvfy g+ p+g++t+W+m+ey++ Lj1g3v1341630.1 94 AVDEKVGIKKYLVFYIGEPPQGTETSWMMQEYHI 127 *9******************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.97E-40 | 6 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 37.853 | 9 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.8E-20 | 10 | 127 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MADGISINLP PGFLFSPTDE ELVLHFLHCK ASFLPCHPNI IPELHHSLLD PWELNGKAFS 60 SGNQYYFFSK VNGNRSTEIG YWKEIGVTEP ILSAVDEKVG IKKYLVFYIG EPPQGTETSW 120 MMQEYHICSS GLDSSPYPSA WGRRKPDMNW SKWVLCRVYE KKRSKQCVNC SCSDDDDSGS 180 ELSWLDEV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-33 | 6 | 166 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-33 | 6 | 166 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-33 | 6 | 166 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-33 | 6 | 166 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-33 | 6 | 166 | 17 | 173 | NAC domain-containing protein 19 |
4dul_A | 3e-33 | 6 | 166 | 14 | 170 | NAC domain-containing protein 19 |
4dul_B | 3e-33 | 6 | 166 | 14 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj1g3v1341630.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027361480.1 | 1e-100 | NAC domain-containing protein 104-like | ||||
Swissprot | Q8GWK6 | 2e-51 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A151ST19 | 5e-95 | A0A151ST19_CAJCA; NAC domain-containing protein 68 | ||||
STRING | GLYMA04G38990.1 | 4e-95 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1736 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 2e-48 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|