PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0282379.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 185aa MW: 21469.9 Da PI: 6.2392 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.8 | 1.3e-14 | 76 | 126 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 ++ rr+++NRe+ArrsR RK+ ++eL v L +eN++L ++l++ ++ Lj0g3v0282379.1 76 RKHRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLLDKLSHASES 126 578***************************************888776654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 5.6E-14 | 72 | 136 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.438 | 74 | 137 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.1E-12 | 76 | 126 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.6E-11 | 76 | 149 | No hit | No description |
SuperFamily | SSF57959 | 4.5E-13 | 76 | 125 | No hit | No description |
CDD | cd14702 | 4.73E-17 | 77 | 128 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 79 | 94 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MQAREAPGLN YMLPSNPPPY PANYTMIQNN IPTFQFQRFS NQLFQVPDFS PQSSCISSNS 60 TSDEADEQQQ GLINERKHRR MISNRESARR SRMRKQRHLD ELWSQVVWLR NENHQLLDKL 120 SHASESHDQV VQENAQLKEE ALELRQMLRD MQIHSPCPSF APLEDAYLRS DSPNQSISSS 180 MDLLG |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 88 | 95 | RRSRMRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.17271 | 0.0 | root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0282379.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT144151 | 0.0 | BT144151.1 Lotus japonicus clone JCVI-FLLj-13H1 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020234398.1 | 8e-91 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 6e-41 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | I3SUK3 | 1e-132 | I3SUK3_LOTJA; Uncharacterized protein | ||||
STRING | GLYMA13G06980.1 | 9e-82 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1604 | 33 | 99 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 7e-56 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|