PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0236609.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 93aa MW: 10405.9 Da PI: 10.1498 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 36.9 | 7.7e-12 | 38 | 88 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 kr++r NR +A rs +RK ++ eLe+kv++L++e + L +l +l+ Lj0g3v0236609.1 38 KRAKRILANRQSAARSKERKTRYTSELERKVQTLQTEATNLSAQLTMLQRD 88 9*****************************************999999765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.4E-9 | 34 | 93 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.001 | 36 | 93 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.7E-12 | 38 | 92 | No hit | No description |
Pfam | PF00170 | 1.3E-10 | 38 | 88 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.2E-12 | 38 | 92 | No hit | No description |
CDD | cd14703 | 2.72E-19 | 39 | 88 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007231 | Biological Process | osmosensory signaling pathway | ||||
GO:0008272 | Biological Process | sulfate transport | ||||
GO:0009294 | Biological Process | DNA mediated transformation | ||||
GO:0009652 | Biological Process | thigmotropism | ||||
GO:0009970 | Biological Process | cellular response to sulfate starvation | ||||
GO:0045596 | Biological Process | negative regulation of cell differentiation | ||||
GO:0051170 | Biological Process | nuclear import | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005829 | Cellular Component | cytosol | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0043621 | Molecular Function | protein self-association | ||||
GO:0051019 | Molecular Function | mitogen-activated protein kinase binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MDGSSTTSFE ADSLMMLDGV KKSMAPDKLA ELALIDPKRA KRILANRQSA ARSKERKTRY 60 TSELERKVQT LQTEATNLSA QLTMLQRDTT DLT |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00184 | DAP | Transfer from AT1G43700 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0236609.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027925351.1 | 5e-55 | transcription factor VIP1-like | ||||
Swissprot | O22873 | 1e-34 | BZP18_ARATH; bZIP transcription factor 18 | ||||
TrEMBL | A0A4D6M145 | 1e-53 | A0A4D6M145_VIGUN; Plant G-box-binding factor | ||||
STRING | XP_007152046.1 | 3e-54 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G40620.1 | 5e-37 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|