PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G43700.1

Common Name

BZIP51, F2J6.6, SUE3, VIP1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 341aa MW: 37790.9 Da PI: 7.3258

Description

VIRE2-interacting protein 1

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G43700.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	30.3	9.2e-10	196	254	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 kr++r NR +A rs +RK ++ eLe+kv++L++e ++L ++ +l+ ++l +e+ AT1G43700.1 196 KRAKRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSELNTEN 254 9***********************************************99999988887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.5E-14	192	256	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.645	194	257	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	3.5E-8	196	254	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.41E-10	196	246	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.7E-8	196	251	No hit	No description
CDD	cd14703	9.41E-22	197	245	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006952	Biological Process	defense response
GO:0007231	Biological Process	osmosensory signaling pathway
GO:0008272	Biological Process	sulfate transport
GO:0009294	Biological Process	DNA mediated transformation
GO:0009652	Biological Process	thigmotropism
GO:0009970	Biological Process	cellular response to sulfate starvation
GO:0045596	Biological Process	negative regulation of cell differentiation
GO:0051170	Biological Process	nuclear import
GO:0005634	Cellular Component	nucleus
GO:0005829	Cellular Component	cytosol
GO:0003682	Molecular Function	chromatin binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0043621	Molecular Function	protein self-association
GO:0051019	Molecular Function	mitogen-activated protein kinase binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000005	anatomy	cultured plant cell
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 341 aa Download sequence Send to blast
MEGGGRGPNQ TILSEIEHMP EAPRQRISHH RRARSETFFS GESIDDLLLF DPSDIDFSSL 60 DFLNAPPPPQ QSQQQPQASP MSVDSEETSS NGVVPPNSLP PKPEARFGRH VRSFSVDSDF 120 FDDLGVTEEK FIATSSGEKK KGNHHHSRSN SMDGEMSSAS FNIESILASV SGKDSGKKNM 180 GMGGDRLAEL ALLDPKRAKR ILANRQSAAR SKERKIRYTG ELERKVQTLQ NEATTLSAQV 240 TMLQRGTSEL NTENKHLKMR LQALEQQAEL RDALNEALRD ELNRLKVVAG EIPQGNGNSY 300 NRAQFSSQQS AMNQFGNKTN QQMSTNGQPS LPSYMDFTKR G

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.22614	0.0	flower\| leaf\| silique\| vegetative tissue

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	42562559	0.0
Genevisible	260813_at	0.0
Expression Atlas	AT1G43700	-
AtGenExpress	AT1G43700	-
ATTED-II	AT1G43700	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in dividing cells, present in leaves, roots and seedlings. {ECO:0000269\|PubMed:15108305, ECO:0000269\|PubMed:15824315}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a VirE2-interacting protein. VIP1 mediates nuclear translocation of VirE2 via its amino half, and interacts with histone H2A via it carboxyl half.
UniProt	Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269\|PubMed:11432846, ECO:0000269\|PubMed:12124400, ECO:0000269\|PubMed:15108305, ECO:0000269\|PubMed:15824315, ECO:0000269\|PubMed:17947581, ECO:0000269\|PubMed:19820165, ECO:0000269\|PubMed:20547563}.

Function -- GeneRIF ? help Back to Top
Data indicate that the ability of VIP1 to interact with the VirE2 protein component of the T-complex and localize to the cell nucleus is sufficient for transient genetic transformation. [PMID: 15824315] study shows VIP1 is a direct target of Agrobacterium-induced MPK3; on phosphorylation by MPK3, VIP1 relocalizes to nucleus & regulates expression of PR1; MAPK-dependent phosphorylation of VIP1 is necessary for VIP1-mediated Agrobacterium T-DNA transfer [PMID: 17947581] provide evidence that VIP1 encodes a functional bZIP transcription factor that stimulates stress-dependent gene expression by binding to VIP1 response elements (VREs), a DNA hexamer motif. [PMID: 19820165] The mutant phenotype of both sue3 and sue4 was specific to sulphate deficiency and the mutants displayed enhanced tolerance to heavy metal and oxidative stress. [PMID: 20547563] The nuclear localization of VIP1 is enhanced by increased turgor. VIP1 functions as a regulator of osmosensory signaling in Arabidopsis. [PMID: 22452852] A VIP1 response element-containing promoter was observed in dividing cells, probably resulting from activation of endogenous VIP1. [PMID: 23942522] Investigated the functions of VIP1, we discovered that VIP1 can react with an Ni(2)-activated derivative of horseradish peroxidase, HisProbe-HRP, suggesting that VIP1 can bind Ni(2). [PMID: 24057918] VIP1 is not important for Agrobacterium-mediated transformation or VirE2 subcellular localization. [PMID: 24953893] When overexpressed in Arabidopsis, some of them as well as VIP1 caused growth retardation under a mannitol-stressed condition, where VIP1 is localized mainly in the cytoplasm. [PMID: 25093810] Developed efficient protocols that resulted in pure and stable His-tagged VIP1 and VirE2, and using the purified proteins, performed peptide array screening and revealed the binding sites on both proteins. [PMID: 25212215] VIP1 suppresses touch-induced responses. [PMID: 27171129] These results raise the possibility that VIP1 influences structures of the root cap and thereby regulates the local auxin responses in roots. [PMID: 27208231] dephosphorylation of VIP1 resulting from mechanical or hypo-osmotic stress induces nuclear localization via 14-3-3 dissociation [PMID: 28542772]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00184	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G43700.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269\|PubMed:15108305}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G43700
IntAct	Search Q9MA75

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Enhanced low sulfur tolerance with higher rate of sulfate uptake at low sulfate levels. Improved tolerance to heavy metal (e.g. CdCl(2)) and oxidative stress (e.g. paraquat). {ECO:0000269\|PubMed:20547563}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G43700

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY065453	0.0	AY065453.1 Arabidopsis thaliana putative VirE2-interacting protein VIP1 (At1g43700) mRNA, complete cds.
GenBank	AY117284	0.0	AY117284.1 Arabidopsis thaliana putative VirE2-interacting protein VIP1 (At1g43700) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_564486.1	0.0	VIRE2-interacting protein 1
Swissprot	Q9MA75	0.0	VIP1_ARATH; Transcription factor VIP1
TrEMBL	A0A178WFF4	0.0	A0A178WFF4_ARATH; VIP1
STRING	AT1G43700.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7993	26	39
Representative plant	OGRP126	17	181

Link Out ? help Back to Top
Phytozome	AT1G43700.1
Entrez Gene	840957
iHOP	AT1G43700
wikigenes	AT1G43700

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Tzfira T,Vaidya M,Citovsky V VIP1, an Arabidopsis protein that interacts with Agrobacterium VirE2, is involved in VirE2 nuclear import and Agrobacterium infectivity. EMBO J., 2001. 20(13): p. 3596-607 [PMID:11432846] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Tzfira T,Vaidya M,Citovsky V Increasing plant susceptibility to Agrobacterium infection by overexpression of the Arabidopsis nuclear protein VIP1. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(16): p. 10435-40 [PMID:12124400] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Avivi Y, et al. Reorganization of specific chromosomal domains and activation of silent genes in plant cells acquiring pluripotentiality. Dev. Dyn., 2004. 230(1): p. 12-22 [PMID:15108305] Tian GW, et al. High-throughput fluorescent tagging of full-length Arabidopsis gene products in planta. Plant Physiol., 2004. 135(1): p. 25-38 [PMID:15141064] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Tzfira T,Vaidya M,Citovsky V Involvement of targeted proteolysis in plant genetic transformation by Agrobacterium. Nature, 2004. 431(7004): p. 87-92 [PMID:15343337] Lacroix B,Vaidya M,Tzfira T,Citovsky V The VirE3 protein of Agrobacterium mimics a host cell function required for plant genetic transformation. EMBO J., 2005. 24(2): p. 428-37 [PMID:15616576] Li J,Krichevsky A,Vaidya M,Tzfira T,Citovsky V Uncoupling of the functions of the Arabidopsis VIP1 protein in transient and stable plant genetic transformation by Agrobacterium. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(16): p. 5733-8 [PMID:15824315] Lee JY, et al. Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60 [PMID:16581911] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Kawabe A,Nasuda S,Charlesworth D Duplication of centromeric histone H3 (HTR12) gene in Arabidopsis halleri and A. lyrata, plant species with multiple centromeric satellite sequences. Genetics, 2006. 174(4): p. 2021-32 [PMID:17028323] Willems G, et al. The genetic basis of zinc tolerance in the metallophyte Arabidopsis halleri ssp. halleri (Brassicaceae): an analysis of quantitative trait loci. Genetics, 2007. 176(1): p. 659-74 [PMID:17409091] Anand A, et al. Arabidopsis VIRE2 INTERACTING PROTEIN2 is required for Agrobacterium T-DNA integration in plants. Plant Cell, 2007. 19(5): p. 1695-708 [PMID:17496122] Cheng C, et al. An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice. BMC Genomics, 2007. 8: p. 175 [PMID:17577400] Shen H,Cao K,Wang X A conserved proline residue in the leucine zipper region of AtbZIP34 and AtbZIP61 in Arabidopsis thaliana interferes with the formation of homodimer. Biochem. Biophys. Res. Commun., 2007. 362(2): p. 425-30 [PMID:17719007] Djamei A,Pitzschke A,Nakagami H,Rajh I,Hirt H Trojan horse strategy in Agrobacterium transformation: abusing MAPK defense signaling. Science, 2007. 318(5849): p. 453-6 [PMID:17947581] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Reiland S, et al. Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks. Plant Physiol., 2009. 150(2): p. 889-903 [PMID:19376835] Pitzschke A,Djamei A,Teige M,Hirt H VIP1 response elements mediate mitogen-activated protein kinase 3-induced stress gene expression. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(43): p. 18414-9 [PMID:19820165] Zaltsman A,Krichevsky A,Loyter A,Citovsky V Agrobacterium induces expression of a host F-box protein required for tumorigenicity. Cell Host Microbe, 2010. 7(3): p. 197-209 [PMID:20227663] Wu Y, et al. Isolation and characterization of low-sulphur-tolerant mutants of Arabidopsis. J. Exp. Bot., 2010. 61(12): p. 3407-22 [PMID:20547563] Van Leene J, et al. Targeted interactomics reveals a complex core cell cycle machinery in Arabidopsis thaliana. Mol. Syst. Biol., 2010. 6: p. 397 [PMID:20706207] Tsugama D,Liu S,Takano T A bZIP protein, VIP1, is a regulator of osmosensory signaling in Arabidopsis. Plant Physiol., 2012. 159(1): p. 144-55 [PMID:22452852] Persak H,Pitzschke A Tight interconnection and multi-level control of Arabidopsis MYB44 in MAPK cascade signalling. PLoS ONE, 2013. 8(2): p. e57547 [PMID:23437396] Lacroix B,Citovsky V Characterization of VIP1 activity as a transcriptional regulator in vitro and in planta. Sci Rep, 2013. 3: p. 2440 [PMID:23942522] Tsugama D,Liu S,Takano T A bZIP protein, VIP1, interacts with Arabidopsis heterotrimeric G protein β subunit, AGB1. Plant Physiol. Biochem., 2013. 71: p. 240-6 [PMID:23974356] Tsugama D,Liu S,Takano T Metal-binding ability of VIP1: a bZIP protein in Arabidopsis thaliana. Protein J., 2013. 32(7): p. 526-32 [PMID:24057918] Wang Y, et al. The putative Agrobacterium transcriptional activator-like virulence protein VirD5 may target T-complex to prevent the degradation of coat proteins in the plant cell nucleus. New Phytol., 2014. 203(4): p. 1266-81 [PMID:24865527] Shi Y,Lee LY,Gelvin SB Is VIP1 important for Agrobacterium-mediated transformation? Plant J., 2014. 79(5): p. 848-60 [PMID:24953893] Tsugama D,Liu S,Takano T Analysis of functions of VIP1 and its close homologs in osmosensory responses of Arabidopsis thaliana. PLoS ONE, 2014. 9(8): p. e103930 [PMID:25093810] Maes M, et al. The disordered region of Arabidopsis VIP1 binds the Agrobacterium VirE2 protein outside its DNA-binding site. Protein Eng. Des. Sel., 2014. 27(11): p. 439-46 [PMID:25212215] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Chen J, et al. ZmbZIP91 regulates expression of starch synthesis-related genes by binding to ACTCAT elements in their promoters. J. Exp. Bot., 2016. 67(5): p. 1327-38 [PMID:26689855] Tsugama D,Liu S,Takano T VIP1 is very important/interesting protein 1 regulating touch responses of Arabidopsis. Plant Signal Behav, 2016. 11(6): p. e1187358 [PMID:27171129] Tsugama D,Liu S,Takano T The bZIP Protein VIP1 Is Involved in Touch Responses in Arabidopsis Roots. Plant Physiol., 2016. 171(2): p. 1355-65 [PMID:27208231] Takeo K,Ito T Subcellular localization of VIP1 is regulated by phosphorylation and 14-3-3 proteins. FEBS Lett., 2017. 591(13): p. 1972-1981 [PMID:28542772] Wang L,Lacroix B,Guo J,Citovsky V The Agrobacterium VirE2 effector interacts with multiple members of the Arabidopsis VIP1 protein family. Mol. Plant Pathol., 2018. 19(5): p. 1172-1183 [PMID:28802023]