PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0424s0008.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 95aa MW: 10505 Da PI: 10.4895 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 48.5 | 1.2e-15 | 53 | 85 | 1 | 33 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 C+ Cg t+Tp WRrgp+g+ tLCn CGl+y ++ Kalax.0424s0008.2.p 53 CEFCGCTETPTWRRGPSGPNTLCNRCGLRYMRN 85 *****************************9766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.558 | 47 | 82 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.1E-11 | 47 | 94 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.24E-13 | 49 | 88 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 6.8E-14 | 50 | 88 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.60E-11 | 52 | 82 | No hit | No description |
Pfam | PF00320 | 7.3E-13 | 53 | 85 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MEQGSNSSQN KQKIDTTLKL GLPQFHREHN SPELIPKPNP KSKGPKVVPG RVCEFCGCTE 60 TPTWRRGPSG PNTLCNRCGL RYMRNQKKAK NAEA* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013893355.1 | 4e-13 | hypothetical protein MNEG_13626 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24050.1 | 1e-11 | GATA transcription factor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0424s0008.2.p |