PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0044s0146.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 176aa MW: 20060.9 Da PI: 4.8381 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.2 | 1.2e-31 | 112 | 170 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ ++Cpvkk+ver++edp++v++tYeg Hnh Kalax.0044s0146.1.p 112 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVEECPVKKRVERDREDPRYVITTYEGVHNHM 170 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.4E-33 | 99 | 172 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.75E-28 | 105 | 172 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.848 | 107 | 172 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.4E-35 | 112 | 171 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-24 | 113 | 169 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MDGNSSDYHN QNMHMSFGSL DCGEVSHAIF ANNEFREDLL DDWFNESGES EVTGQDLGLQ 60 DPVHQMNQVN GLEVNYNAQD EEPDTRESGG RTGRAPVQSK VAFKTKSEIE ILDDGFKWRK 120 YGKKMVKNSP NPRNYYKCSV EECPVKKRVE RDREDPRYVI TTYEGVHNHM SPSGY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-25 | 102 | 173 | 7 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-25 | 102 | 173 | 7 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027085414.1 | 8e-49 | probable WRKY transcription factor 50 | ||||
Refseq | XP_027182807.1 | 8e-49 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 4e-44 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A3R5T0G4 | 6e-52 | A0A3R5T0G4_PAELC; WRKY protein | ||||
STRING | VIT_04s0008g01470.t01 | 1e-47 | (Vitis vinifera) | ||||
STRING | XP_008445519.1 | 8e-48 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-46 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0044s0146.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|