PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0013s0219.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 103aa MW: 11514.2 Da PI: 5.2174 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 47.9 | 5.3e-15 | 17 | 95 | 13 | 89 |
GAGA_bind 13 yyepa.aslkenlg.lqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllven 89 y+p +++++ + +++m +++erda+ ernl lsek+a++a+rdma ++rd+a+aer+ a+ erd +++l+l en Kalax.0013s0219.1.p 17 EYKPFqDQVQQRASmKDIMVMVSERDAAFLERNLVLSEKRAVLAQRDMAVVERDAAIAERDIAIKERDRVMAHLQLLEN 95 55544334444443158*********************************************************99887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF06217 | 3.2E-6 | 23 | 91 | IPR010409 | GAGA-binding transcriptional activator |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MDKGGPGRLQ YGPPKGEYKP FQDQVQQRAS MKDIMVMVSE RDAAFLERNL VLSEKRAVLA 60 QRDMAVVERD AAIAERDIAI KERDRVMAHL QLLENITDGD TA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001275364.1 | 2e-22 | protein BASIC PENTACYSTEINE6-like | ||||
Refseq | XP_006342016.1 | 2e-22 | PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 | ||||
Refseq | XP_006342018.1 | 2e-22 | PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 | ||||
Refseq | XP_015161877.1 | 2e-22 | PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 | ||||
Swissprot | Q8L999 | 9e-19 | BPC6_ARATH; Protein BASIC PENTACYSTEINE6 | ||||
TrEMBL | A0A0V0I8A9 | 5e-21 | A0A0V0I8A9_SOLCH; Uncharacterized protein | ||||
TrEMBL | H1ZN97 | 5e-21 | H1ZN97_SOLTU; GAGA-binding transcriptional activator | ||||
STRING | PGSC0003DMT400009534 | 8e-22 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G42520.2 | 6e-12 | basic pentacysteine 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0013s0219.1.p |