PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0955s0002.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 266aa MW: 29246.1 Da PI: 9.377 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.6 | 1.7e-19 | 15 | 60 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd+ l +v+q+G ++W+tI+r ++ gRt+k+c++rw + Kaladp0955s0002.1.p 15 KGPWSPEEDDALNTLVQQHGARNWSTISRSIP-GRTGKSCRLRWCNQ 60 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 52.7 | 1e-16 | 69 | 111 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEde +++a++++G++ W+tIar + gRt++ +k++w++ Kaladp0955s0002.1.p 69 PFSQEEDETIIRAHARFGNK-WATIARFLT-GRTDNAIKNHWNST 111 89******************.********9.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.793 | 10 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.75E-32 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-15 | 14 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-17 | 15 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-26 | 16 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.38E-15 | 17 | 59 | No hit | No description |
PROSITE profile | PS51294 | 20.745 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.6E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-23 | 69 | 115 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.2E-14 | 69 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.01E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 266 aa Download sequence Send to blast |
MAMSCGRRDT SDRIKGPWSP EEDDALNTLV QQHGARNWST ISRSIPGRTG KSCRLRWCNQ 60 LSPQVQHRPF SQEEDETIIR AHARFGNKWA TIARFLTGRT DNAIKNHWNS TLKRKCSAVR 120 SGPEPTRPLK RSVSAGAAPV QFYPGSPSGS DSSESSNQGL VKMASLSEEL ETSLSLSLSL 180 PGQVADSAEL TQSPAVQMSV EQQIAKRIEA RMPENGPVGL TTEMMGVMQE MIRKEVRSYM 240 AGMEMCSSGF RDHMGLSRIG FSKID* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-38 | 14 | 116 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-38 | 14 | 116 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-38 | 14 | 116 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020210181.1 | 3e-95 | transcription factor MYB44 | ||||
Swissprot | O23160 | 1e-78 | MYB73_ARATH; Transcription factor MYB73 | ||||
Swissprot | Q9FDW1 | 8e-79 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A151U424 | 7e-94 | A0A151U424_CAJCA; Transcription factor MYB44 | ||||
STRING | XP_007155887.1 | 2e-92 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 1e-69 | myb domain protein r1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0955s0002.1.p |