PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00031397-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 173aa MW: 20302.4 Da PI: 10.5082 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 179.2 | 1.1e-55 | 17 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrFhPtdeel+v+yL+++++++++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nrat sgyWkatg+dk+ WALNUT_00031397-RA 17 LPPGFRFHPTDEELIVFYLRNQAKSRPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKA 106 79****************************.89***************99999************************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++s +++ vg+kk Lvfykgr pkg+ktdW+mheyrl WALNUT_00031397-RA 107 IYS-GSQYVGVKKALVFYKGRPPKGVKTDWIMHEYRL 142 ***.99*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.89E-63 | 13 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.074 | 17 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.2E-27 | 18 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MIRKVRSMEG KHNGSGLPPG FRFHPTDEEL IVFYLRNQAK SRPCPVSIIP EVDIYKFDPW 60 QLPEKTEFGE NEWYFFSPRD RKYPNGVRPN RATVSGYWKA TGTDKAIYSG SQYVGVKKAL 120 VFYKGRPPKG VKTDWIMHEY RLNDSRKQPN KHMGSMRVSK LAFWLLLHRF PTF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
3swm_B | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
3swm_C | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
3swm_D | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
3swp_A | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
3swp_B | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
3swp_C | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
3swp_D | 4e-61 | 17 | 170 | 20 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018853677.1 | 1e-122 | PREDICTED: NAC transcription factor 29-like | ||||
Swissprot | K4BNG7 | 9e-93 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | A0A2I4HC39 | 1e-121 | A0A2I4HC39_JUGRE; NAC transcription factor 29-like | ||||
STRING | EMJ24523 | 5e-96 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4103 | 32 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 7e-95 | NAC-like, activated by AP3/PI |
Publications ? help Back to Top | |||
---|---|---|---|
|