PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00017504-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 155aa MW: 17639.5 Da PI: 5.09 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 156 | 6.4e-49 | 5 | 99 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +q+r+lPianv+rimk++lPa +kisk+ k+t+qec++efisfvt+easdkc++e+rkt+ngdd++wal+tlGf++y+e++ yl kyre+e+ WALNUT_00017504-RA 5 QQERLLPIANVGRIMKQILPATTKISKEGKQTMQECATEFISFVTAEASDKCHKENRKTVNGDDICWALSTLGFDNYAEAIVRYLYKYREAER 97 799*****************************************************************************************9 PP NF-YB 96 ek 97 +k WALNUT_00017504-RA 98 QK 99 86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.1E-49 | 4 | 130 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.94E-38 | 6 | 129 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.4E-25 | 9 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.8E-18 | 37 | 55 | No hit | No description |
PRINTS | PR00615 | 4.8E-18 | 56 | 74 | No hit | No description |
PRINTS | PR00615 | 4.8E-18 | 75 | 93 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MDDDQQERLL PIANVGRIMK QILPATTKIS KEGKQTMQEC ATEFISFVTA EASDKCHKEN 60 RKTVNGDDIC WALSTLGFDN YAEAIVRYLY KYREAERQKA NQNKGINSSQ DKQLEESNYR 120 NDQLGKQTHE DPHAPLEFRA IDEKGDHSQA EAAST |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-39 | 5 | 94 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-39 | 5 | 94 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00133 | DAP | Transfer from AT1G09030 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018843553.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_018858115.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 4e-58 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A2I4GI23 | 1e-113 | A0A2I4GI23_JUGRE; nuclear transcription factor Y subunit B-4-like | ||||
STRING | cassava4.1_026425m | 2e-69 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 2e-60 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|