PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00017448-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 110aa MW: 12509.3 Da PI: 6.2263 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 84.2 | 1.9e-26 | 21 | 79 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Flkkly +++d+e+++++sws+ nsfvv++++efa+k+Lpk+Fkh+nfaSF+RQLn+Y WALNUT_00017448-RA 21 FLKKLYAMVDDPETDSVVSWSNGDNSFVVWNPHEFASKLLPKHFKHNNFASFIRQLNTY 79 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 2.1E-28 | 12 | 79 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 6.2E-23 | 17 | 109 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 2.31E-24 | 19 | 79 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 8.8E-23 | 21 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 8.2E-15 | 21 | 44 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 8.2E-15 | 59 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 8.2E-15 | 72 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MADANDAGSS TTATTNPLPP FLKKLYAMVD DPETDSVVSW SNGDNSFVVW NPHEFASKLL 60 PKHFKHNNFA SFIRQLNTYV GYLYLFFYLL SLLFFLLFLC KMLGLISESN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 3e-19 | 8 | 79 | 17 | 87 | Heat shock factor protein 1 |
5d5v_B | 3e-19 | 8 | 79 | 17 | 87 | Heat shock factor protein 1 |
5d5v_D | 3e-19 | 8 | 79 | 17 | 87 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018847277.1 | 3e-51 | PREDICTED: heat stress transcription factor A-1b-like | ||||
Swissprot | Q9SCW5 | 9e-30 | HFA1E_ARATH; Heat stress transcription factor A-1e | ||||
TrEMBL | A0A2I4GTQ9 | 7e-50 | A0A2I4GTQ9_JUGRE; heat stress transcription factor A-1b-like | ||||
STRING | Bra001071.1-P | 5e-30 | (Brassica rapa) | ||||
STRING | PGSC0003DMT400082752 | 5e-30 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G02990.1 | 1e-30 | heat shock transcription factor A1E |
Publications ? help Back to Top | |||
---|---|---|---|
|