Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 93.8 | 7.8e-30 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
+rienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gkl+ +
WALNUT_00004405-RA 9 ERIENKINRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSSRGKLFQF 57
69********************************************999 PP
|
2 | K-box | 96.6 | 3.7e-32 | 76 | 171 | 5 | 100 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95
+++++ e+ +++l++e+++L++++e+Lqr+qRh+lGedLe+L+lkeLq+Le+qL+k l++ R++K++++l+ +eel++ke+ l e nk+L+
WALNUT_00004405-RA 76 QDTDVVEQGTQTLYREITRLRAKYESLQRSQRHMLGEDLEPLNLKELQNLEKQLDKTLSRARQRKTQIMLDRLEELRQKERCLGEMNKQLK 166
677899999********************************************************************************** PP
K-box 96 kklee 100
+k+ee
WALNUT_00004405-RA 167 SKIEE 171
***97 PP
|
Protein Features
? help Back to Top |
|
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
SMART | SM00432 | 1.2E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.385 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.89E-33 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.91E-43 | 2 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 16.655 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 9.8E-28 | 85 | 169 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009553 | Biological Process | embryo sac development |
GO:0009911 | Biological Process | positive regulation of flower development |
GO:0010094 | Biological Process | specification of carpel identity |
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem |
GO:0010582 | Biological Process | floral meristem determinacy |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:0048455 | Biological Process | stamen formation |
GO:0048459 | Biological Process | floral whorl structural organization |
GO:0048509 | Biological Process | regulation of meristem development |
GO:0048833 | Biological Process | specification of floral organ number |
GO:0080060 | Biological Process | integument development |
GO:0080112 | Biological Process | seed growth |
GO:0005634 | Cellular Component | nucleus |
GO:0003677 | Molecular Function | DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0046983 | Molecular Function | protein dimerization activity |