PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S07681.10 | ||||||||
Common Name | JCGZ_05582, LOC105628143 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 132aa MW: 13898.9 Da PI: 8.3723 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 123.7 | 9.6e-39 | 46 | 130 | 1 | 85 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +l++ Jcr4S07681.10 46 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICHLTK 130 7********************************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.283 | 45 | 132 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 9.2E-39 | 46 | 130 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MEYSEAAASN TAAAAATNSS SPSSSASPPQ TPTFTPPPPV PVVVSPCAAC KILRRRCADK 60 CVLAPYFPPT EPAKFTIAHR VFGASNIIKF LQELPESQRA DAVSSMVYEA SARIRDPVYG 120 CAGAICHLTK TN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-37 | 38 | 130 | 3 | 95 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-37 | 38 | 130 | 3 | 95 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012064881.1 | 1e-88 | LOB domain-containing protein 11 | ||||
Swissprot | Q9SK08 | 6e-57 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | A0A067LHN9 | 3e-87 | A0A067LHN9_JATCU; Uncharacterized protein | ||||
STRING | XP_006488170.1 | 4e-61 | (Citrus sinensis) | ||||
STRING | XP_006424648.1 | 5e-61 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1303 | 34 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 3e-52 | LOB domain-containing protein 11 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105628143 |
Publications ? help Back to Top | |||
---|---|---|---|
|