PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S01613.40 | ||||||||
Common Name | JCGZ_20534, LOC105646043, WRKY20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 161aa MW: 18485 Da PI: 9.8654 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.3 | 2e-30 | 82 | 140 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s + rsYYrCt+++C+vkk+++r ++d ++v++tYeg Hnh+ Jcr4S01613.40 82 LDDGYRWRKYGQKVVKNSIHQRSYYRCTQHTCNVKKQIQRLSKDSSIVVTTYEGIHNHP 140 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.1E-31 | 69 | 140 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.62E-27 | 75 | 141 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 27.887 | 77 | 142 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.4E-35 | 82 | 141 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.4E-24 | 83 | 140 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MATHNQLGQE IDQFAPSSDI DWVSLLSGSL KFGDQNHHQP PVARDNIGEN VNTNKIKKGG 60 CKAKRVVPQR IAFHTRSADD ILDDGYRWRK YGQKVVKNSI HQRSYYRCTQ HTCNVKKQIQ 120 RLSKDSSIVV TTYEGIHNHP CEKVMETLSP LLRELQFLSR I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 1e-23 | 70 | 139 | 2 | 71 | WRKY transcription factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC485272 | 1e-172 | KC485272.1 Jatropha curcas WRKY transcription factor 20 (WRKY20) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012087204.1 | 1e-119 | probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 3e-56 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | S5CK97 | 1e-118 | S5CK97_JATCU; WRKY transcription factor 20 | ||||
STRING | XP_002509864.1 | 1e-78 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 1e-58 | WRKY DNA-binding protein 56 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105646043 |
Publications ? help Back to Top | |||
---|---|---|---|
|