PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S00004.310

Common Name

JCGZ_26234, LOC105648592

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

MYB_related

Protein Properties

Length: 88aa MW: 10120.9 Da PI: 9.8915

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S00004.310	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.9	4.7e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv+ + +G +W+++++ g++R++k+c++rw +yl Jcr4S00004.310 14 KGPWTAEEDKKLVNFIFTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.3E-23	5	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.196	9	65	IPR017930	Myb domain
SMART	SM00717	5.5E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.0E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.24E-19	15	88	IPR009057	Homeodomain-like
CDD	cd00167	1.65E-10	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.0E-5	63	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLVNFIF THGQCCWRAV PKLAGLRRCG KSCRLRWTNY 60 LRPDLKRGLL NEAEENLVIE LHALLGNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-16	14	88	7	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269\|PubMed:15805488}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM034733	1e-147	KM034733.1 Jatropha curcas clone JcMYB113 MYB family protein gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012090417.1	1e-59	protein ODORANT1
Swissprot	Q50EX6	6e-53	ODO1_PETHY; Protein ODORANT1
TrEMBL	A0A067JHX7	3e-58	A0A067JHX7_JATCU; MYB family protein
STRING	XP_008376445.1	3e-57	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G12350.1	1e-58	myb domain protein 42

Link Out ? help Back to Top
Entrez Gene	105648592

Publications ? help Back to Top
Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC ODORANT1 regulates fragrance biosynthesis in petunia flowers. Plant Cell, 2005. 17(5): p. 1612-24 [PMID:15805488] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971]