PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G12350.1 | ||||||||
Common Name | AtMYB42, MYB42 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 286aa MW: 32402.2 Da PI: 5.5874 | ||||||||
Description | myb domain protein 42 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.6 | 3.8e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l++ + G +W++ ++ g++R++k+c++rw +yl AT4G12350.1 14 KGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.6 | 4.5e-16 | 71 | 111 | 5 | 47 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + E++l +d++++lG++ W++Ia++++ gRt++++k++w+++ AT4G12350.1 71 SDAEEQLVIDLHALLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111 778***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-20 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.864 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 6.2E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.99E-26 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.7E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.87E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.214 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.7E-24 | 63 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.22E-11 | 71 | 112 | No hit | No description |
Pfam | PF00249 | 3.0E-14 | 71 | 111 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0005352 | anatomy | xylem | ||||
PO:0009005 | anatomy | root | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 286 aa Download sequence Send to blast |
MGRQPCCDKL MVKKGPWTAE EDKKLINFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY 60 LRPDLKRGLL SDAEEQLVID LHALLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKME 120 IDPSTHQPLN KVFTDTNLVD KSETSSKADN VNDNKIVEID GTTTNTIDDS IITHQNSSND 180 DYELLGDIIH NYGDLFNILW TNDEPPLVDD ASWSNHNVGI GGTAAVAASD KNNTAAEEDF 240 PERSFEKQNG ESWMFLDYCQ EFGVEDFGFE CYHGFGQSSM KTGHKD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-28 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 254813_at | 0.0 | ||||
Expression Atlas | AT4G12350 | - | ||||
AtGenExpress | AT4G12350 | - | ||||
ATTED-II | AT4G12350 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269|PubMed:15805488}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269|PubMed:15805488}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a putative transcription factor (MYB42). | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G12350.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT1G32770 (A) |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G12350 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF175999 | 0.0 | AF175999.1 Arabidopsis thaliana putative transcription factor (MYB42) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_567390.4 | 0.0 | myb domain protein 42 | ||||
Swissprot | Q50EX6 | 2e-90 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | Q9SPG1 | 0.0 | Q9SPG1_ARATH; Myb domain protein 42 | ||||
STRING | AT4G12350.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G12350.1 |
Entrez Gene | 826844 |
iHOP | AT4G12350 |
wikigenes | AT4G12350 |