PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc032464.1_g00001.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

NAC

Protein Properties

Length: 59aa MW: 6925.98 Da PI: 4.6289

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc032464.1_g00001.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	56.1	1.3e-17	13	59	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 +ppGfrFhPt+eel+++yL+kk++++k++l +vi+++d++k+ePwd++ Itr_sc032464.1_g00001.1 13 VPPGFRFHPTEEELLQYYLRKKIASQKIDL-DVIPDIDLNKLEPWDIQ 59 69**************************.9***********985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.62E-18	6	58	IPR003441	NAC domain
PROSITE profile	PS51005	20.281	13	59	IPR003441	NAC domain
Pfam	PF02365	1.3E-8	14	56	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MKNLCVNGES QVVPPGFRFH PTEEELLQYY LRKKIASQKI DLDVIPDIDL NKLEPWDIQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues such as tracheary elements. {ECO:0000269\|PubMed:16214898}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019160434.1	2e-28	PREDICTED: NAC domain-containing protein 12-like
Refseq	XP_027080579.1	1e-27	NAC domain-containing protein 12-like
Refseq	XP_027183246.1	1e-27	NAC domain-containing protein 12
Swissprot	Q9M274	4e-27	NAC66_ARATH; NAC domain-containing protein 66
TrEMBL	A0A287VJ51	9e-28	A0A287VJ51_HORVV; Uncharacterized protein
TrEMBL	A0A446RIP5	9e-28	A0A446RIP5_TRITD; Uncharacterized protein
TrEMBL	A0A446RJ37	1e-27	A0A446RJ37_TRITD; Uncharacterized protein
TrEMBL	A0A453QJA5	2e-27	A0A453QJA5_AEGTS; Uncharacterized protein
STRING	Traes_7DS_5CB1C2862.2	2e-28	(Triticum aestivum)
STRING	TRIUR3_14545-P1	3e-28	(Triticum urartu)
STRING	TRIUR3_34215-P1	1e-27	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA134	24	297

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G61910.1	2e-29	NAC domain protein 66

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622]