PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc005771.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 84aa MW: 8505.56 Da PI: 4.078 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 25 | 4.9e-08 | 52 | 83 | 2 | 33 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-H CS HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvlde 33 Fl+k++ +++d++++ +i w ++++sfvv+d+ Itr_sc005771.1_g00001.1 52 FLSKTFAMVDDPNTDAIIAWGASKKSFVVWDP 83 9********************999******96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 2.3E-9 | 47 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 2.58E-7 | 48 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 7.8E-6 | 52 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MVAESLGIDG GGGGVTVKVE AEVVVVDECD DGGNGGLRSM EGVKGVGGPA PFLSKTFAMV 60 DDPNTDAIIA WGASKKSFVV WDPH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE). Involved in heat stress response. {ECO:0000269|PubMed:18064488}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019192499.1 | 6e-25 | PREDICTED: heat shock factor protein HSF30-like isoform X1 | ||||
Refseq | XP_019192500.1 | 6e-25 | PREDICTED: heat stress transcription factor A-2-like isoform X2 | ||||
Swissprot | Q6F388 | 3e-15 | HFA2E_ORYSJ; Heat stress transcription factor A-2e | ||||
TrEMBL | A0A1S4CRR3 | 4e-17 | A0A1S4CRR3_TOBAC; heat stress transcription factor A-7a-like | ||||
STRING | XP_009606363.1 | 7e-18 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA572 | 24 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G63350.1 | 3e-15 | HSF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|