PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc003236.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 139aa MW: 15623.1 Da PI: 10.4005 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 68.4 | 6.6e-22 | 21 | 70 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien+ r vtfskR + ++KKA+E+S+LC++e+a+++fs++gk +++s+ Itr_sc003236.1_g00002.1 21 RIENEVHRLVTFSKRCTSLFKKASEMSTLCGTEIAMVVFSPSGKPFTFSN 70 9***********************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.4E-23 | 12 | 71 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 22.792 | 12 | 72 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.06E-23 | 13 | 86 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-17 | 14 | 34 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.8E-23 | 21 | 68 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-17 | 34 | 49 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-17 | 49 | 70 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MSLRNTSRGV TRGRHRVLLA RIENEVHRLV TFSKRCTSLF KKASEMSTLC GTEIAMVVFS 60 PSGKPFTFSN PDMDTVLTKY FGEIPTTDAN IIRPIIHAHQ EAKMRAMTSQ INILEAQIDE 120 EMLVNQALRE AKKGRSSIA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3kov_B | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3kov_I | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3kov_J | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_A | 5e-17 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_B | 5e-17 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_C | 5e-17 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_D | 5e-17 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_A | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_B | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_C | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_D | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_I | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
3p57_J | 1e-16 | 13 | 80 | 1 | 68 | Myocyte-specific enhancer factor 2A |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019198284.1 | 4e-49 | PREDICTED: agamous-like MADS-box protein AGL61 | ||||
Refseq | XP_019198287.1 | 3e-49 | PREDICTED: agamous-like MADS-box protein AGL61 | ||||
TrEMBL | A0A484NMH5 | 1e-40 | A0A484NMH5_9ASTE; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA204 | 24 | 223 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24840.1 | 1e-23 | AGAMOUS-like 61 |