PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G24840.1

Common Name

AGL61, DIA, F27C12.24

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 264aa MW: 30264.3 Da PI: 10.1557

Description

AGAMOUS-like 61

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G24840.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	67.4	1.4e-21	72	114	3	45
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 i+ +s rqvtfskRr+g++KKA+EL++LC+ae+ +i+fs+ k AT2G24840.1 72 IKKESHRQVTFSKRRAGLFKKASELCTLCGAEIGIIVFSPAKK 114 8999***********************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.4E-30	62	121	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	23.591	62	122	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.86E-34	63	130	No hit	No description
SuperFamily	SSF55455	7.98E-28	63	140	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.2E-17	64	84	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.1E-25	71	118	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.2E-17	84	99	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.2E-17	99	120	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009559	Biological Process	embryo sac central cell differentiation
GO:0043078	Cellular Component	polar nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009089	anatomy	endosperm
PO:0020090	anatomy	embryo sac central cell

Sequence ? help Back to Top
Protein Sequence Length: 264 aa Download sequence Send to blast
MYVTKYKNKL PTLQVDLIIM PHQTQACIYK QTLSLHQIFQ QRKATKTLHT KKTMMSKKKE 60 SIGRQKIPMV KIKKESHRQV TFSKRRAGLF KKASELCTLC GAEIGIIVFS PAKKPFSFGH 120 PSVESVLDRY VSRNNMSLAQ SQQLQGSPAA SCELNMQLTH ILSEVEEEKK KGQAMEEMRK 180 ESVRRSMINW WEKPVEEMNM VQLQEMKYAL EELRKTVVTN MASFNEAKDD VFGFLDNKVT 240 VPPYVNMPSG PSNIYNFANG NGCF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3kov_B	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3kov_I	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3kov_J	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3p57_A	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3p57_B	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3p57_C	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3p57_D	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3p57_I	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
3p57_J	5e-15	63	134	1	72	Myocyte-specific enhancer factor 2A
5f28_A	5e-15	62	134	1	73	MEF2C
5f28_B	5e-15	62	134	1	73	MEF2C
5f28_C	5e-15	62	134	1	73	MEF2C
5f28_D	5e-15	62	134	1	73	MEF2C
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	240254526	0.0
Genevisible	263525_at	0.0
Expression Atlas	AT2G24840	-
AtGenExpress	AT2G24840	-
ATTED-II	AT2G24840	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in the final stages of embryo sac development. {ECO:0000269\|PubMed:18713950}.
Uniprot	TISSUE SPECIFICITY: Expressed exclusively in the central cell of the female gametophyte and in early endosperm. {ECO:0000269\|PubMed:18599653, ECO:0000269\|PubMed:18713950}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the Agamous-like family of transcription factors. Localized to the nucleus in the central cell and endosperm of the female gametophyte. Loss of function mutations show reduced female fertility. Fifty percent of ovules have defective central cells with abnormal morphology and patterns of gene expression. Upon fertilization 50% of seeds abort. Using yeast two hybrid assays AGL61 was shown to interact with AGL80, another MADS box gene with similar defects in ovule development. These data suggest that AGL61 and 80 together are required for proper differentiation of the central cell.
UniProt	Probable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269\|PubMed:18599653, ECO:0000269\|PubMed:18713950}.

Function -- GeneRIF ? help Back to Top
controls the expression of downstream genes during central cell development [PMID: 18599653] DIANA (AGL61) forms a complex with AGL80 to specify the central cell in Arabidopsis ovules. [AGL61] [DIANA] [PMID: 18713950] Data show that AGL61 and AGL80 appear to function together to differentiate the central cell in Arabidopsis. Data renamed AGL61 DIANA, after the virginal Roman goddess of the hunt. [PMID: 18713950]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G24840.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G48670
IntAct	Search Q4PSU4

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G24840

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC006585	0.0	AC006585.8 Arabidopsis thaliana chromosome 2 clone F27C12 map mi238, complete sequence.
GenBank	CP002685	0.0	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBank	DQ056542	0.0	DQ056542.1 Arabidopsis thaliana MADS-box family protein (At2g24840) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_850058.1	0.0	AGAMOUS-like 61
Swissprot	Q4PSU4	0.0	AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBL	C0SV61	1e-155	C0SV61_ARATH; Uncharacterized protein At2g24840 (Fragment)
STRING	AT2G24840.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM86	28	390
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G24840.1
Entrez Gene	817021
iHOP	AT2G24840
wikigenes	AT2G24840

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Johnston AJ, et al. Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte. Genome Biol., 2007. 8(10): p. R204 [PMID:17915010] Steffen JG,Kang IH,Portereiko MF,Lloyd A,Drews GN AGL61 interacts with AGL80 and is required for central cell development in Arabidopsis. Plant Physiol., 2008. 148(1): p. 259-68 [PMID:18599653] Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules. Plant Cell, 2008. 20(8): p. 2088-101 [PMID:18713950] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]