PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc001123.1_g00001.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

NAC

Protein Properties

Length: 78aa MW: 9046.57 Da PI: 4.7231

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc001123.1_g00001.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	51	4.8e-16	19	64	2	48
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 ppGfrF+Ptdeel v+yLk+k+ ++++ l +vi e+d+yk eP++Lp Itr_sc001123.1_g00001.1 19 PPGFRFQPTDEELAVYYLKRKICRRPIML-DVIGETDVYKREPEELP 64 9***********************999.99************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.49E-18	15	68	IPR003441	NAC domain
PROSITE profile	PS51005	18.138	18	78	IPR003441	NAC domain
Pfam	PF02365	9.3E-8	19	66	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MELTSEPSSC SCLCGQRFPP GFRFQPTDEE LAVYYLKRKI CRRPIMLDVI GETDVYKREP 60 EELPGIAFFS LPIYQLLL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269\|PubMed:24045017}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold and drought stresses. {ECO:0000269\|PubMed:17158162}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019175354.1	2e-37	PREDICTED: NAC domain-containing protein 17-like isoform X1
Swissprot	Q9XIC5	5e-19	NAC17_ARATH; NAC domain-containing protein 17
TrEMBL	A0A2Z7D386	9e-22	A0A2Z7D386_9LAMI; Uncharacterized protein
STRING	Solyc04g072220.2.1	5e-21	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA134	24	297

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G34190.1	2e-21	NAC domain containing protein 17

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Van Aken O, et al. Mitochondrial and Chloroplast Stress Responses Are Modulated in Distinct Touch and Chemical Inhibition Phases. Plant Physiol., 2016. 171(3): p. 2150-65 [PMID:27208304] Van Aken O,Ford E,Lister R,Huang S,Millar AH Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance. Plant J., 2016. 88(4): p. 542-558 [PMID:27425258] Hu Z, et al. Mitochondrial Defects Confer Tolerance against Cellulose Deficiency. Plant Cell, 2016. 28(9): p. 2276-2290 [PMID:27543091] Chi YH, et al. The membrane-tethered NAC transcription factor, AtNTL7, contributes to ER-stress resistance in Arabidopsis. Biochem. Biophys. Res. Commun., 2017. 488(4): p. 641-647 [PMID:28088515] Van Aken O,Pogson BJ Convergence of mitochondrial and chloroplastic ANAC017/PAP-dependent retrograde signalling pathways and suppression of programmed cell death. Cell Death Differ., 2017. 24(6): p. 955-960 [PMID:28498364] Cheng P, et al. The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis. Front Plant Sci, 2018. 9: p. 182 [PMID:29497438]