PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc001123.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 78aa MW: 9046.57 Da PI: 4.7231 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 51 | 4.8e-16 | 19 | 64 | 2 | 48 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 ppGfrF+Ptdeel v+yLk+k+ ++++ l +vi e+d+yk eP++Lp Itr_sc001123.1_g00001.1 19 PPGFRFQPTDEELAVYYLKRKICRRPIML-DVIGETDVYKREPEELP 64 9*************************999.99**************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.49E-18 | 15 | 68 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 18.138 | 18 | 78 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.3E-8 | 19 | 66 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MELTSEPSSC SCLCGQRFPP GFRFQPTDEE LAVYYLKRKI CRRPIMLDVI GETDVYKREP 60 EELPGIAFFS LPIYQLLL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019175354.1 | 2e-37 | PREDICTED: NAC domain-containing protein 17-like isoform X1 | ||||
Swissprot | Q9XIC5 | 5e-19 | NAC17_ARATH; NAC domain-containing protein 17 | ||||
TrEMBL | A0A2Z7D386 | 9e-22 | A0A2Z7D386_9LAMI; Uncharacterized protein | ||||
STRING | Solyc04g072220.2.1 | 5e-21 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA134 | 24 | 297 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34190.1 | 2e-21 | NAC domain containing protein 17 |