PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000189.1_g00014.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 242aa MW: 27298.8 Da PI: 9.5498 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 162.9 | 1.2e-50 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+++d++k++PwdLp e+e yfFs+r+ ky++g+r++rat sgyWkat Itr_sc000189.1_g00014.1 14 LPPGFRFHPTDEELVVQYLKRKVFSCPLPA-SIIPDFDVCKSDPWDLPGD---WEQERYFFSTREVKYPNGNRSSRATGSGYWKAT 95 79****************************.89***************44...46799**************************** PP NAM 87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 g dk++ s +++lvg+kktLvfykg+ap+g++tdW+mheyrl Itr_sc000189.1_g00014.1 96 GIDKQIASCrGRQLVGMKKTLVFYKGKAPHGSRTDWIMHEYRL 138 ******99757778***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.15E-61 | 5 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.892 | 14 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.8E-27 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MEKMSFVKNG VLRLPPGFRF HPTDEELVVQ YLKRKVFSCP LPASIIPDFD VCKSDPWDLP 60 GDWEQERYFF STREVKYPNG NRSSRATGSG YWKATGIDKQ IASCRGRQLV GMKKTLVFYK 120 GKAPHGSRTD WIMHEYRLAN APTSQHPPNN NQNWVLCRVF LKKRPGKKED EETEMRGAAS 180 LGNGTKPVFY DFLARERADL NLAPASSSSG SSGVTVLSSN HQTEDHEESS SCSSFTTLRT 240 KP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-51 | 12 | 168 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-51 | 12 | 168 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-51 | 12 | 168 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-51 | 12 | 168 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
3swm_B | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
3swm_C | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
3swm_D | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
3swp_A | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
3swp_B | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
3swp_C | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
3swp_D | 8e-51 | 12 | 168 | 18 | 174 | NAC domain-containing protein 19 |
4dul_A | 8e-51 | 12 | 168 | 15 | 171 | NAC domain-containing protein 19 |
4dul_B | 8e-51 | 12 | 168 | 15 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019199829.1 | 1e-166 | PREDICTED: NAC domain-containing protein 83 isoform X4 | ||||
Swissprot | Q9FY93 | 1e-104 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A482ETG6 | 1e-125 | A0A482ETG6_IPOBA; NAC14 | ||||
STRING | cassava4.1_014491m | 1e-122 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1387 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-105 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|