PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_74469.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 136aa MW: 13853.2 Da PI: 4.5158 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 77.1 | 5e-24 | 5 | 65 | 94 | 154 |
DUF702 94 aeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 ++s+ ++P+e+s eavfrcvr++ vd+ ++e+aYqtavsigGh+fkGiL+d+G++e MLOC_74469.2 5 TTSSAGEGDGRFPPELSLEAVFRCVRIGPVDEPDAEFAYQTAVSIGGHTFKGILRDHGPAE 65 44555566677***********************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 8.1E-21 | 9 | 64 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 3.4E-19 | 15 | 63 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
GO:0010252 | Biological Process | auxin homeostasis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048479 | Biological Process | style development | ||||
GO:0048480 | Biological Process | stigma development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MVDATTSSAG EGDGRFPPEL SLEAVFRCVR IGPVDEPDAE FAYQTAVSIG GHTFKGILRD 60 HGPAEEAAGQ LPPSSAEYHQ LTGAAREGSS PAGSSEAAGG HGATVATSAA VLMDPYPTPI 120 GAFAAGTQFF PHNPRT |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00613 | PBM | Transfer from AT3G51060 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_74469.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB678347 | 0.0 | AB678347.1 Hordeum vulgare subsp. vulgare Lks2 gene for putative short internodesfamily transcription factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020192925.1 | 2e-88 | protein SHI RELATED SEQUENCE 1-like | ||||
Refseq | XP_020192926.1 | 2e-88 | protein SHI RELATED SEQUENCE 1-like | ||||
TrEMBL | A0A287XEN8 | 4e-92 | A0A287XEN8_HORVV; Putative short internodesfamily transcription factor | ||||
STRING | MLOC_74469.1 | 3e-89 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66350.1 | 8e-24 | Lateral root primordium (LRP) protein-related |