PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_72525.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 168aa MW: 18246.7 Da PI: 10.4392 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 139 | 1.7e-43 | 38 | 136 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 +CaaCk+lrrkC++dCv+apyfp ++p+kf vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+v+vi+ lq++l+ql+++la++ MLOC_72525.2 38 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAVISILQRNLRQLQQDLARA 134 7*********************************************************************************************998 PP DUF260 98 ke 99 k MLOC_72525.2 135 KY 136 76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.379 | 37 | 138 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.7E-43 | 38 | 134 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009799 | Biological Process | specification of symmetry | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0009954 | Biological Process | proximal/distal pattern formation | ||||
GO:0048441 | Biological Process | petal development | ||||
GO:0005654 | Cellular Component | nucleoplasm |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MASSSASSLP APGGSVITLA ASSAGGNGAG GVCGTGSPCA ACKFLRRKCQ PDCVFAPYFP 60 PDNPQKFVHV HRVFGASNVT KLLNELHPYQ REDAVNSLAY EADMRLRDPV YGCVAVISIL 120 QRNLRQLQQD LARAKYELSK YQRRGQTGRR RWRSSSAALS RTAWRASS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-55 | 34 | 141 | 7 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-55 | 34 | 141 | 7 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00211 | DAP | Transfer from AT1G65620 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_72525.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK373607 | 0.0 | AK373607.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3036G24. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020194937.1 | 5e-87 | LOB domain-containing protein 6-like | ||||
Refseq | XP_020194938.1 | 5e-87 | LOB domain-containing protein 6-like | ||||
Swissprot | Q32SG3 | 5e-84 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
TrEMBL | A0A287M8A9 | 1e-119 | A0A287M8A9_HORVV; Uncharacterized protein | ||||
STRING | MLOC_72525.1 | 1e-102 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 8e-55 | LBD family protein |