PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_72368.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 108aa MW: 12494.3 Da PI: 12.2234 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 35.1 | 2.9e-11 | 5 | 49 | 2 | 46 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 ++++ rr NR +A+rsR RK+++i eLe+ v +L++e +aL MLOC_72368.3 5 RPRRHNRRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALS 49 67788999*******************************998886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 9.5E-11 | 4 | 68 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.9E-10 | 4 | 59 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.243 | 6 | 62 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.25E-11 | 8 | 62 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 4.8E-14 | 9 | 62 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 11 | 26 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14703 | 1.21E-19 | 11 | 59 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
PISQRPRRHN RRILANRQSA QRSRVRKLQY ISELERSVTS LQTEVSALSP RVAFLDHQRS 60 LLTLGNSHLK QRIAALAQDK IFKDGDRHCH PSQLLVFRNF APATVKFN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_72368.3 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by dehydration and salt stress. {ECO:0000269|PubMed:18065552}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT036821 | 2e-88 | BT036821.1 Zea mays full-length cDNA clone ZM_BFb0141B19 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015694867.1 | 4e-42 | PREDICTED: basic leucine zipper 2-like | ||||
Swissprot | Q5QNI5 | 4e-44 | BZP02_ORYSJ; Basic leucine zipper 2 | ||||
TrEMBL | A0A287KV43 | 8e-65 | A0A287KV43_HORVV; Uncharacterized protein | ||||
STRING | Traes_3AS_6AE36A662.1 | 1e-58 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58120.1 | 7e-39 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|