PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_6821.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 119aa MW: 13564.2 Da PI: 8.2414 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.3 | 8.8e-19 | 45 | 92 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd+ lv++++ +G g+W++ ar g++Rt+k+c++rw++yl MLOC_6821.3 45 RGPWTVEEDLTLVNYIADHGDGRWNSLARGAGLKRTGKSCRLRWLNYL 92 89*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.304 | 40 | 96 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-22 | 40 | 95 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.8E-15 | 44 | 94 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-17 | 45 | 92 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.92E-22 | 46 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.33E-12 | 47 | 92 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-7 | 96 | 119 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MASWSSSSTQ RRSGVSSGAT MPCSVMKFDD DLLRHEEEAA EEIRRGPWTV EEDLTLVNYI 60 ADHGDGRWNS LARGAGLKRT GKSCRLRWLN YLRPDVKRGN FTADEQLLIL DLHSRWGNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-16 | 42 | 119 | 24 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_6821.3 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK360551 | 0.0 | AK360551.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1120I18. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020162380.1 | 8e-62 | myb-related protein 340-like | ||||
Swissprot | Q2QZJ8 | 6e-48 | JAMYB_ORYSJ; Transcription factor JAMYB | ||||
TrEMBL | M0YDN6 | 3e-82 | M0YDN6_HORVV; Uncharacterized protein | ||||
STRING | MLOC_6821.2 | 1e-81 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27810.1 | 6e-44 | myb domain protein 21 |
Publications ? help Back to Top | |||
---|---|---|---|
|