PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_66924.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 167aa MW: 19238 Da PI: 9.3463 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171 | 3.7e-53 | 11 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 +ppGfrFhPt+eel+++yL+kkv++++++l +vi+++d++k+ePwd+++ k+ + +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ MLOC_66924.1 11 VPPGFRFHPTEEELLNYYLRKKVASEEIDL-DVIRDIDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYN 106 69****************************.9***************952444443456************************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +g++ktLvfykgrap+g+k+dW+mheyrl MLOC_66924.1 107 -AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139 .8899***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.19E-54 | 7 | 142 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.987 | 11 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.8E-29 | 12 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009809 | Biological Process | lignin biosynthetic process | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0009901 | Biological Process | anther dehiscence | ||||
GO:0010047 | Biological Process | fruit dehiscence | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEEIDL DVIRDIDLNK LEPWDIQEKC 60 KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY 120 KGRAPHGQKS DWIMHEYRLD DLPTIVTDAA PTATMVRMRD HLAQLCS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 4e-46 | 11 | 139 | 15 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00321 | DAP | Transfer from AT2G46770 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_66924.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK248449 | 0.0 | AK248449.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf176e18, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020164672.1 | 1e-109 | NAC domain-containing protein 43-like | ||||
Swissprot | Q84WP6 | 1e-92 | NAC43_ARATH; NAC domain-containing protein 43 | ||||
TrEMBL | A0A287WY05 | 1e-122 | A0A287WY05_HORVV; Uncharacterized protein | ||||
STRING | MLOC_66924.2 | 1e-113 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46770.1 | 5e-84 | NAC family protein |