PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_63274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB
Protein Properties Length: 237aa    MW: 26437.8 Da    PI: 6.5054
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_63274.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.6e-162672248
                     SSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     + WT+eEd+ll + v+++Gg+ +W+ I r ++ gR  k+c++rw ++l
     MLOC_63274.1 26 KMWTKEEDDLLREQVRRYGGPhNWDNICRALP-GRNSKSCRLRWCQHL 72
                     67******************************.***********9986 PP

2Myb_DNA-binding47.63.9e-1581123347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T eEd l+v++ + +G++ W+tIa+ +  gRt++ +k+rw+++
     MLOC_63274.1  81 PFTREEDMLIVKYQAAYGNR-WSTIAEFLS-GRTDNAVKNRWNSV 123
                      89******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9932076IPR017930Myb domain
SuperFamilySSF466896.44E-2824120IPR009057Homeodomain-like
SMARTSM007172.6E-122474IPR001005SANT/Myb domain
PfamPF002491.3E-132572IPR001005SANT/Myb domain
CDDcd001671.15E-132872No hitNo description
Gene3DG3DSA:1.10.10.601.1E-162877IPR009057Homeodomain-like
SMARTSM007171.3E-1378126IPR001005SANT/Myb domain
PROSITE profilePS5129417.77681128IPR017930Myb domain
PfamPF002491.3E-1281124IPR001005SANT/Myb domain
CDDcd001677.09E-1281124No hitNo description
Gene3DG3DSA:1.10.10.603.7E-1981125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MTPPSSFPGN DAGACDDDGS PHGVKKMWTK EEDDLLREQV RRYGGPHNWD NICRALPGRN  60
SKSCRLRWCQ HLDPRVEAVK PFTREEDMLI VKYQAAYGNR WSTIAEFLSG RTDNAVKNRW  120
NSVLRKRQEH APSQQGQTRS WAPAAARQAA GPEVTPRCLP LFPGSPEDVP DAETCAPTRE  180
CLDLFPLAPG DIIRGNAAAA APPSDMSCGL GDPLTELRIW PEERVVFDVM PLQAYRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262812730127MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_63274.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519190.0JF951919.1 Triticum aestivum clone TaMYB21 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020148042.11e-149transcription factor MYB44-like
RefseqXP_020155292.11e-149transcription factor MYB44-like
TrEMBLA0A287PDR11e-176A0A287PDR1_HORVV; Uncharacterized protein
STRINGMLOC_63274.11e-176(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.13e-36myb domain protein 77