PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_58027.7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 99aa MW: 11203.9 Da PI: 10.8697 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.4 | 2.8e-12 | 1 | 46 | 10 | 55 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + +NRe+ArrsR+RK a++ Le v++L++e +L k+l e +++ MLOC_58027.7 1 MVSNRESARRSRRRKHAQLTDLELQVEQLKNESATLFKQLTEANQQ 46 579**********************************777776665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57959 | 2.25E-9 | 1 | 47 | No hit | No description |
PROSITE profile | PS50217 | 9.197 | 1 | 46 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.7E-9 | 1 | 46 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 3.6E-10 | 2 | 47 | No hit | No description |
SMART | SM00338 | 2.4E-4 | 3 | 56 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MVSNRESARR SRRRKHAQLT DLELQVEQLK NESATLFKQL TEANQQFTTA VTDNRILKSD 60 VETLRIKVKM AEDMVARGAV SCGLGQQLGL APFLNSRKM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that possesses broad binding specificity for DNA promoter elements with the core sequence 5'-ACGT-3'. May be involved in the regulation of genes expressed during seed development (PubMed:7919992). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:7919992}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_58027.7 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK361338 | 1e-153 | AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02. | |||
GenBank | AK363257 | 1e-153 | AK363257.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013M10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020167700.1 | 3e-64 | basic leucine zipper 9-like isoform X1 | ||||
Refseq | XP_020167701.1 | 3e-64 | basic leucine zipper 9-like isoform X2 | ||||
Swissprot | Q6ETX0 | 3e-49 | RSBZ3_ORYSJ; bZIP transcription factor RISBZ3 | ||||
TrEMBL | M7ZTE2 | 6e-64 | M7ZTE2_TRIUA; Regulatory protein opaque-2 | ||||
STRING | TRIUR3_09193-P1 | 1e-64 | (Triticum urartu) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24800.1 | 9e-26 | basic leucine zipper 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|