PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_52315.7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 142aa MW: 15463.3 Da PI: 7.1581 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 51.4 | 3.6e-16 | 106 | 140 | 1 | 36 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rk MLOC_52315.7 106 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRK 140 69****************************.99998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 0.0034 | 104 | 142 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 20.188 | 105 | 142 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.3E-11 | 107 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 110 | 130 | IPR018362 | CCAAT-binding factor, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MTSVADAVSG DHRADEQQQK QAAHGNQEEA PATSIGNQAM AATPSTDYVT PYGHQEACHA 60 MGQIAYPTID PYYGSLYAAY GGQPMMHPPM VGMHAAAIPL PTDAIEEPVY VNAKQYNAIL 120 RRRQSRAKAE SERKLIKGRK YS |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_52315.7 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK363934 | 0.0 | AK363934.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2020D05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020186181.1 | 1e-93 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
Refseq | XP_020186182.1 | 1e-93 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
TrEMBL | M0WKA5 | 1e-100 | M0WKA5_HORVV; Uncharacterized protein | ||||
STRING | MLOC_52315.1 | 3e-97 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12840.3 | 8e-25 | nuclear factor Y, subunit A1 |