Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | CBFB_NFYA | 97.7 | 1.2e-30 | 171 | 227 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RR++Rak+e e+k+ ++ rkpylheSRhkhA+rR+R+sgGrF
AT5G12840.3 171 QEPVYVNAKQYEGILRRRKARAKAELERKV-IRDRKPYLHESRHKHAMRRARASGGRF 227
69****************************.**************************9 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Gusmaroli G,Tonelli C,Mantovani R
Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana. Gene, 2001. 264(2): p. 173-85 [PMID:11250072] - Gusmaroli G,Tonelli C,Mantovani R
Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] - Zik M,Irish VF
Global identification of target genes regulated by APETALA3 and PISTILLATA floral homeotic gene action. Plant Cell, 2003. 15(1): p. 207-22 [PMID:12509532] - Stevens R, et al.
A CDC45 homolog in Arabidopsis is essential for meiosis, as shown by RNA interference-induced gene silencing. Plant Cell, 2004. 16(1): p. 99-113 [PMID:14660803] - Wang XJ,Reyes JL,Chua NH,Gaasterland T
Prediction and identification of Arabidopsis thaliana microRNAs and their mRNA targets. Genome Biol., 2004. 5(9): p. R65 [PMID:15345049] - Ditt RF, et al.
The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens. Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81 [PMID:16776300] - Wenkel S, et al.
CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell, 2006. 18(11): p. 2971-84 [PMID:17138697] - Chen NZ, et al.
AtHAP3b plays a crucial role in the regulation of flowering time in Arabidopsis during osmotic stress. J. Biochem. Mol. Biol., 2007. 40(6): p. 1083-9 [PMID:18047807] - Yazawa K,Kamada H
Identification and characterization of carrot HAP factors that form a complex with the embryo-specific transcription factor C-LEC1. J. Exp. Bot., 2007. 58(13): p. 3819-28 [PMID:18057048] - Day RC,Herridge RP,Ambrose BA,Macknight RC
Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol., 2008. 148(4): p. 1964-84 [PMID:18923020] - Hackenberg D, et al.
Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y. Mol Plant, 2012. 5(4): p. 876-88 [PMID:22199235] - Mu J,Tan H,Hong S,Liang Y,Zuo J
Arabidopsis transcription factor genes NF-YA1, 5, 6, and 9 play redundant roles in male gametogenesis, embryogenesis, and seed development. Mol Plant, 2013. 6(1): p. 188-201 [PMID:22933713] - Li YJ, et al.
NFYA1 is involved in regulation of postgermination growth arrest under salt stress in Arabidopsis. PLoS ONE, 2013. 8(4): p. e61289 [PMID:23637805] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Hou X, et al.
Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis. Nat Commun, 2014. 5: p. 4601 [PMID:25105952] - Siriwardana CL, et al.
NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T. PLoS Genet., 2016. 12(12): p. e1006496 [PMID:27977687] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] - Edwards D,Murray JA,Smith AG
Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. Plant Physiol., 1998. 117(3): p. 1015-22 [PMID:9662544]
|