PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_52125.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 152aa MW: 16339.2 Da PI: 9.9973 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.7 | 2.9e-14 | 30 | 88 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsR+RK++++eeL ++ L+aeN + ++ ++ e k++ e+ MLOC_52125.3 30 RKRKRMLSNRESARRSRARKQQRMEELIAEASRLQAENARVEAQIGAYTTELTKVDGEN 88 57899****************************************99999998887765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 4.8E-13 | 26 | 84 | No hit | No description |
SMART | SM00338 | 1.7E-19 | 26 | 90 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 1.2E-10 | 28 | 80 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.496 | 28 | 91 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.31E-11 | 30 | 83 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 33 | 48 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MSSPSRRSSS PESNIDGGSG SGSGSAGDER KRKRMLSNRE SARRSRARKQ QRMEELIAEA 60 SRLQAENARV EAQIGAYTTE LTKVDGENAV LRARHGELAG RLQALGGVLE IFQVAGAPVD 120 IPEIPDPLLR PWQSPFAPQL ATAGGVPDAF QF |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 42 | 49 | RRSRARKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_52125.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK361449 | 0.0 | AK361449.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1140N16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020158427.1 | 4e-75 | ocs element-binding factor 1-like | ||||
Swissprot | P24068 | 2e-33 | OCS1_MAIZE; Ocs element-binding factor 1 | ||||
TrEMBL | F2DC34 | 1e-104 | F2DC34_HORVV; Predicted protein | ||||
STRING | MLOC_52125.1 | 1e-104 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 8e-23 | basic region/leucine zipper motif 53 |
Publications ? help Back to Top | |||
---|---|---|---|
|