PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_36942.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 147aa MW: 16960.5 Da PI: 10.055 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 161.3 | 3.6e-50 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppG+rFhPtd el +yLk+k+ gkkl++ ++++evdiyk+ Pw+Lp k ++ +++ +wyfF++r +ky+ g r+nr+t+ gyWkatgkd++v+ MLOC_36942.2 6 LPPGYRFHPTDVELTLYYLKRKLLGKKLHC-NTVAEVDIYKFPPWELPaKsSMPTGDLQWYFFCTRGRKYSVGYRTNRSTEGGYWKATGKDRQVVY- 100 79****************************.88***************4246666888**************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++vg+k+tLvf+ g+apkg++tdWvm eyrl MLOC_36942.2 101 ENRTVGMKRTLVFHAGKAPKGTRTDWVMYEYRL 133 9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.01E-55 | 2 | 138 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 50.762 | 6 | 147 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.5E-26 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MDMPPLPPGY RFHPTDVELT LYYLKRKLLG KKLHCNTVAE VDIYKFPPWE LPAKSSMPTG 60 DLQWYFFCTR GRKYSVGYRT NRSTEGGYWK ATGKDRQVVY ENRTVGMKRT LVFHAGKAPK 120 GTRTDWVMYE YRLAQGEIPD AGARLAG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-46 | 6 | 133 | 15 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00583 | DAP | Transfer from AT5G64060 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_36942.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK370777 | 0.0 | AK370777.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2116L22. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020181654.1 | 1e-88 | NAC domain-containing protein 82-like | ||||
Refseq | XP_020181655.1 | 1e-88 | NAC domain-containing protein 82-like | ||||
Swissprot | A4VCM0 | 4e-56 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
TrEMBL | M0VST0 | 1e-104 | M0VST0_HORVV; Uncharacterized protein | ||||
STRING | MLOC_36942.1 | 1e-105 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G03200.1 | 3e-49 | NAC domain containing protein 45 |
Publications ? help Back to Top | |||
---|---|---|---|
|