PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_16981.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 88aa MW: 10322.9 Da PI: 9.3877 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.7 | 1.3e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+lv++++ +G g+W+ ++++ g+ R++k+c++rw +yl MLOC_16981.3 14 RGLWSPEEDEKLVRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61 789*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.3E-26 | 6 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.505 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 3.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.1E-22 | 16 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.29E-11 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-9 | 64 | 88 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.125 | 66 | 88 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901430 | Biological Process | positive regulation of syringal lignin biosynthetic process | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MGHHSCCNQQ KVKRGLWSPE EDEKLVRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY 60 LRPDIRRGRF TPEEEKLIIS LHAIVGNR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_16981.3 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK111808 | 1e-110 | AK111808.1 Oryza sativa Japonica Group cDNA clone:J013114D05, full insert sequence. | |||
GenBank | AK112117 | 1e-110 | AK112117.1 Oryza sativa Japonica Group cDNA clone:002-129-C03, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009112912.1 | 6e-62 | PREDICTED: transcription factor MYB46 | ||||
Refseq | XP_013673354.1 | 5e-62 | transcription factor MYB86-like | ||||
Refseq | XP_019151107.1 | 4e-62 | PREDICTED: transcription factor MYB46-like | ||||
Swissprot | Q9SPG3 | 2e-48 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | A0A3P5XXF1 | 8e-61 | A0A3P5XXF1_BRACM; Uncharacterized protein | ||||
STRING | Bra027668.1-P | 2e-61 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G63910.1 | 2e-61 | myb domain protein 103 |
Publications ? help Back to Top | |||
---|---|---|---|
|