PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G013238.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 167aa MW: 18978.8 Da PI: 10.6007 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46 | 1.2e-14 | 32 | 76 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT+eE++++++a +++ + Wk+I +g +t q++s+ qky HL.SW.v1.0.G013238.1 32 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 76 789*****************77.*********.*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.05E-17 | 26 | 82 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.724 | 27 | 81 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.2E-8 | 29 | 85 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 9.0E-19 | 30 | 79 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 6.8E-12 | 31 | 79 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-12 | 32 | 76 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.20E-9 | 34 | 77 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MNSNPSNNPQ TTTPSDGSAK KVRKPYTITK SRESWTEEEH DKFLEALQLF DRDWKKIEDF 60 VGSKTVIQIR SHAQKYFQKV QKNGTLAHVP PPRPKRKAAH PYPQKASKNV LVPLQASLGY 120 PSMNAMVPTY SPWDEASLLI SPASSRIMAQ KCKWFKHSRP YMKPLV* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024024231.1 | 2e-90 | protein REVEILLE 8 isoform X2 | ||||
Swissprot | Q8RWU3 | 3e-72 | RVE8_ARATH; Protein REVEILLE 8 | ||||
TrEMBL | W9RLU7 | 7e-89 | W9RLU7_9ROSA; Transcription factor ASG4 | ||||
STRING | XP_010100834.1 | 1e-89 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6735 | 34 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09600.2 | 2e-58 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|