Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 44.8 | 2.9e-14 | 43 | 87 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
r +WT+eE++++++a +++ + Wk+I +g +t q++s+ qky
AT3G09600.2 43 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 87
789*****************77.*********.*************9 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Rizhsky L,Davletova S,Liang H,Mittler R
The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis. J. Biol. Chem., 2004. 279(12): p. 11736-43 [PMID:14722088] - S
ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis. Plant J., 2004. 38(3): p. 381-95 [PMID:15086800] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Gutierrez L, et al.
Identification of new gene expression regulators specifically expressed during plant seed maturation. J. Exp. Bot., 2006. 57(9): p. 1919-32 [PMID:16606634] - Manfield IW, et al.
Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis. Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9 [PMID:16845059] - Lee DJ, et al.
Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response. Mol. Genet. Genomics, 2007. 277(2): p. 115-37 [PMID:17061125] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Agudelo-Romero P, et al.
Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus. Virol. J., 2008. 5: p. 92 [PMID:18684336] - Rawat R, et al.
REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8 [PMID:19805390] - Farinas B,Mas P
Functional implication of the MYB transcription factor RVE8/LCL5 in the circadian control of histone acetylation. Plant J., 2011. 66(2): p. 318-29 [PMID:21205033] - Farinas B,Mas P
Histone acetylation and the circadian clock: a role for the MYB transcription factor RVE8/LCL5. Plant Signal Behav, 2011. 6(4): p. 541-3 [PMID:21474993] - Rawat R, et al.
REVEILLE8 and PSEUDO-REPONSE REGULATOR5 form a negative feedback loop within the Arabidopsis circadian clock. PLoS Genet., 2011. 7(3): p. e1001350 [PMID:21483796] - James AB,Syed NH,Brown JW,Nimmo HG
Thermoplasticity in the plant circadian clock: how plants tell the time-perature. Plant Signal Behav, 2012. 7(10): p. 1219-23 [PMID:22902701] - Hsu PY,Harmer SL
Circadian phase has profound effects on differential expression analysis. PLoS ONE, 2012. 7(11): p. e49853 [PMID:23185460] - Hsu PY,Devisetty UK,Harmer SL
Accurate timekeeping is controlled by a cycling activator in Arabidopsis. Elife, 2013. 2: p. e00473 [PMID:23638299] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Xie Q, et al.
LNK1 and LNK2 are transcriptional coactivators in the Arabidopsis circadian oscillator. Plant Cell, 2014. 26(7): p. 2843-57 [PMID:25012192] - Fogelmark K,Troein C
Rethinking transcriptional activation in the Arabidopsis circadian clock. PLoS Comput. Biol., 2014. 10(7): p. e1003705 [PMID:25033214] - P
Time-dependent sequestration of RVE8 by LNK proteins shapes the diurnal oscillation of anthocyanin biosynthesis. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(16): p. 5249-53 [PMID:25848001] - Xing H, et al.
LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors. Plant Signal Behav, 2015. 10(3): p. e1010888 [PMID:25848708] - Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]
|