PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Han007966 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 164aa MW: 18334.3 Da PI: 10.5083 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.1 | 3.5e-17 | 39 | 83 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT+eE+ ++++a k++G W++I +++g ++t+ q++s+ qk+ Han007966 39 REKWTEEEHNRFLEALKLHGRA-WRRIEEHVG-TKTAVQIRSHAQKF 83 789*****************88.*********.************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 7.18E-17 | 33 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.339 | 34 | 88 | IPR017930 | Myb domain |
TIGRFAMs | TIGR01557 | 1.1E-16 | 37 | 86 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 6.7E-13 | 38 | 86 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-10 | 39 | 79 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 8.6E-15 | 39 | 82 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.48E-11 | 41 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MAEDLSEGSV SNAIKSNQFT SADAYAPKVR KPYTITKQRE KWTEEEHNRF LEALKLHGRA 60 WRRIEEHVGT KTAVQIRSHA QKFFSKVVRE STSGDASEVK PIEIPPPRHK RKPMHPYPRK 120 PSAPLKMGGQ HERSTSPNSS GSDQENQSPT SVLPTGGSSI FGLX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022012179.1 | 1e-112 | protein REVEILLE 2-like | ||||
Swissprot | F4KGY6 | 5e-51 | RVE1_ARATH; Protein REVEILLE 1 | ||||
TrEMBL | A0A251S962 | 1e-111 | A0A251S962_HELAN; Putative myb domain, plant, Homeodomain-like protein | ||||
STRING | XP_009613640.1 | 7e-62 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G17300.1 | 2e-48 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|