PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN43823.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 60aa MW: 6987.05 Da PI: 11.0885 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 35.7 | 2e-11 | 4 | 40 | 11 | 47 |
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 l++++ + +G+g+Wk Iar+ k+Rt q+ s+ qky KHN43823.1 4 LFLQGLAIYGKGDWKNIARYAVKTRTSTQVASHAQKY 40 79**********************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.116 | 1 | 45 | IPR017930 | Myb domain |
CDD | cd00167 | 4.12E-7 | 3 | 41 | No hit | No description |
TIGRFAMs | TIGR01557 | 1.8E-11 | 3 | 43 | IPR006447 | Myb domain, plants |
SuperFamily | SSF46689 | 3.04E-12 | 3 | 45 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-6 | 4 | 40 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.7E-8 | 4 | 40 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 60 aa Download sequence Send to blast |
HYRLFLQGLA IYGKGDWKNI ARYAVKTRTS TQVASHAQKY FLHLRASNKK GKRKSIYDTT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN43823.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006605600.1 | 2e-34 | myb-like protein J | ||||
Swissprot | Q9FNN6 | 9e-19 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A0B2PKU2 | 9e-36 | A0A0B2PKU2_GLYSO; Transcription factor MYB1R1 (Fragment) | ||||
STRING | XP_008806104.1 | 7e-22 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF20197 | 2 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09450.1 | 1e-21 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|