PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN33564.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 66aa MW: 7417.7 Da PI: 10.8154 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 82.3 | 3.1e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskR+ g++KKA ELS LCd e+a+i+fs+ gkl++y+s KHN33564.1 9 KKIDNVTARQVTFSKRKSGLFKKARELSLLCDSEIALIVFSPGGKLFDYAS 59 68***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.9E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.609 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.30E-33 | 3 | 61 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-26 | 3 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.8E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.8E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.8E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MVRRKIPIKK IDNVTARQVT FSKRKSGLFK KARELSLLCD SEIALIVFSP GGKLFDYASS 60 SENVTQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN33564.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 4e-54 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028203158.1 | 6e-36 | MADS-box protein JOINTLESS-like | ||||
Refseq | XP_028203159.1 | 6e-36 | MADS-box protein JOINTLESS-like | ||||
Swissprot | Q9FUY6 | 8e-26 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A445GPV2 | 1e-34 | A0A445GPV2_GLYSO; MADS-box protein JOINTLESS isoform A | ||||
STRING | GLYMA15G06314.1 | 2e-35 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 3e-27 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|